KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10124Help
Entry
Dmel_CG10124      CDS       T00030                                 

Gene name
eIF4E-4
Definition
CG10124 gene product from transcript CG10124-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG10124 (eIF4E-4)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG10124 (eIF4E-4)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmel_CG10124 (eIF4E-4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:65C1-65C1
AA seq 229 aa AA seqDB search
MLTTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTL
WYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDD
ANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT
ANGHNELAVMEIGLKLRDLLVLPPHQLQYQLHKDTMCKQGSVIKAVYCV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgacccagcagaccgaattcaagatgatggacaacggcaccgagacgctggcc
gattctccttcgagttccagcgaggatctgaaaacgctttcggatatggatattcgcaag
cccgtaacggagattgttgatttgcgccttaagcatccgctagagaacacttggacactg
tggtacttggagaatgatcgcagcaagaactgggaggacatgcagaacgagattactagc
tttgacatggtcgaggacttctggagtctctacaatcacattaagcagccatctgagatt
agagtgggcagcgattattctttgttcaagaagggcattcagccaatgtgggaggatgat
gcgaacaagttcggcggccgttgggtcatcaatatggggcgtggctccaaagcggagctc
gacaagctttggttagatgtgctactcatactgattggcgaggcctttgaaaacaccgag
gaagtctgcggcgccgttatcaacttgcgcgggaagagcaacaaaatttcgatttggacc
gccaacgggcacaacgagctggccgtcatggagattggactcaagttacgcgacctgctc
gtcctgccgccccaccaactgcagtaccagctgcacaaggacactatgtgcaagcaggga
tcggtgatcaaagcggtttattgcgtgtaa

DBGET integrated database retrieval system