KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10181Help
Entry
Dmel_CG10181      CDS       T00030                                 

Gene name
Mdr65
Definition
Multiple drug resistance 65 (EC:3.6.1.3 3.6.3.44)
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:65A10-65A10
AA seq 1302 aa AA seqDB search
MERDEVSTSSSEGKSQEEAPMAEGLEPTEPIAFLKLFRFSTYGEIGWLFFGFIMCCIKAL
TLPAVVIIYSEFTSMLVDRAMQFGTSSNVHALPLFGGGKTLTNASREENNEALYDDSISY
GILLTIASVVMFISGIFSVDVFNMVALRQVTRMRIKLFSSVIRQDIGWHDLASKQNFTQS
MVDDVEKIRDGISEKVGHFVYLVVGFIITVAISFSYGWKLTLAVSSYIPLVILLNYYVAK
FQGKLTAREQESYAGAGNLAEEILSSIRTVVSFGGEKSEVQRYENFLVPARKASQWKGAF
SGLSDAVLKSMLYLSCAGAFWYGVNLIIDDRNVENKEYTPAILMIAFFGIIVGADNIART
APFLESFATARGCATNLFKVIDLTSKIDPLSTDGKLLNYGLRGDVEFQDVFFRYPSRPEV
IVHRGLNIRIRAGQTVALVGSSGCGKSTCVQLLQRFYDPVFGSVLLDDLDIRKYNIQWLR
SNIAVVGQEPVLFLGTIAQNISYGKPGATQKEIEAAATQAGAHEFITNLPESYRSMIGER
GSQLSGGQKQRIAIARALIQNPKILLLDEATSALDYQSEKQVQQALDLASKGRTTIVVSH
RLSAIRGADKIVFIHDGKVLEEGSHDDLMALEGAYYNMVRAGDINMPDEVEKEDSIEDTK
QKSLALFEKSFETSPLNFEKGQKNSVQFEEPIIKALIKDTNAQSAEAPPEKPNFFRTFSR
ILQLAKQEWCYLILGTISAVAVGFLYPAFAVIFGEFYAALAEKDPEDALRRTAVLSWACL
GLAFLTGLVCFLQTYLFNYAGIWLTTRMRAMTFNAMVNQEVGWFDDENNSVGALSARLSG
EAVDIQGAIGYPLSGMIQALSNFISSVSVAMYYNWKLALLCLANCPIIVGSVILEAKMMS
NAVVREKQVIEEACRIATESITNIRTVAGLRREADVIREYTEEIQRVEVLIRQKLRWRGV
LNSTMQASAFFAYAVALCYGGVLVSEGQLPFQDIIKVSETLLYGSMMLAQSLAFTPAFSA
ALIAGHRLFQILDRKPKIQSPMGTIKNTLAKQLNLFEGVRYRGIQFRYPTRPDAKILNGL
DLEVLKGQTVALVGHSGCGKSTCVQLLQRYYDPDEGTIHIDHDDIQHDLTLDGVRTKLGI
VSQEPTLFERSIAENIAYGDNRRSVSMVEIIAAAKSANAHSFIISLPNGYDTRMGARGTQ
LSGGQKQRIAIARALVRNPKILLLDEATSALDLQSEQLVQQALDTACSGRTCIVIAHRLS
TVQNADVICVIQNGQVVEQGNHMQLISQGGIYAKLHKTQKDH
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagatgaggtgtccacctcgagcagcgagggcaaatcacaggaggaggcgccc
atggcggagggtttggagcccacagagcctattgcattcctgaaactttttcgattctcc
acctacggggagattggctggctgttcttcggcttcataatgtgctgcattaaggcactg
acccttcctgccgtggtcattatctacagtgagttcacgtccatgttggtggaccgcgcc
atgcagtttggcaccagttcaaatgttcatgccctgccacttttcggaggtggtaaaaca
ctaacaaatgcctctcgggaggaaaacaatgaagccttatacgatgattccatatcgtat
ggaattcttctgaccattgcatccgtggtgatgttcatctcaggaattttctctgtggat
gtcttcaatatggtggcgctgcgtcaggtcacaaggatgcgaataaaactgttttcatcc
gtgattcgtcaagacatcggttggcatgatctggccagcaagcaaaactttacccaaagc
atggtggacgacgtggaaaagattcgagatggcatctcagagaaagttggtcactttgta
taccttgtagttggatttatcataactgtggccatttcatttagctacggctggaaactt
accttagctgtgagctcttatatacctctggtgatcttattaaattattacgtagctaag
tttcaaggcaagctgactgcccgagaacaagaatcctatgcgggagctggaaatttggca
gaggaaattctgagttccatacgcactgtggtctcgtttggtggagaaaaatcagaggtg
cagcgctatgagaatttcttggtcccagctcgaaaggcaagtcaatggaaaggagccttc
tcggggctcagcgatgcggttttgaagtccatgttgtatctgtcatgcgccggagcattt
tggtatggtgtcaatcttattatcgatgatcgaaatgtggaaaacaaggagtatacaccg
gctattctgatgattgccttctttggtatcattgttggtgcggacaacatagccagaaca
gctcctttcctggagtcttttgccaccgcacgcggctgtgccaccaacctcttcaaggtc
atcgatctgacatccaagatcgatcccctatctacagacggtaaacttttgaactacggc
ctacgtggtgatgtggagttccaggatgtcttctttcgatatccctctcgtccggaggtg
attgtacacaggggcctaaacattaggattagagctggtcaaacagtggccttggttggt
tcttctggctgtggaaagtccacctgtgtccaattgctgcagaggttctacgatcctgtg
tttggatcagttcttttggatgatttggacataagaaagtacaatatccaatggttgaga
tcgaatattgccgttgtgggtcaggaaccagtgctatttttgggcacaatagctcaaaac
attagctatggtaagccaggagccacgcaaaaagagatcgaagcagctgccactcaggcg
ggtgcacatgaattcattaccaatctgccagagagttatcgcagtatgattggagagcgg
ggatcccagctctctggaggtcagaaacaacgcatagccatcgctcgagcccttatccag
aatccgaagatcctgctgctggatgaagccacctctgcactggattaccaatccgagaaa
caggttcaacaggccttggacttggccagtaaaggtcgtacaaccattgtggtctctcat
cgattgtcagctattcgaggtgcagataagattgtctttattcatgatggtaaggttctg
gaggaaggttcccatgatgatttaatggcgctggaaggtgcatactacaacatggttcgt
gccggcgatatcaacatgcccgatgaggtagaaaaagaggacagcattgaggacaccaaa
caaaaaagcctggctctgtttgagaaatcctttgagacgagtccattaaacttcgagaaa
ggtcaaaagaacagtgtccagtttgaggaacctataataaaggcactcatcaaggataca
aatgcccagtcagctgaggctccgccggagaaaccgaacttcttccgcactttctctagg
atccttcagcttgccaaacaggaatggtgctacctgattcttggaactataagtgctgta
gcagtgggatttttgtatccagctttcgcggtcatcttcggagaattctatgctgctttg
gctgaaaaggatccggaggacgcactgcgtcgtactgctgttctatcctgggcctgcttg
ggcctggcattcttgaccggattggtttgcttccttcagacctatttgtttaactacgcg
ggcatttggcttaccaccagaatgcgagccatgaccttcaatgcgatggtgaatcaggaa
gttggatggttcgacgacgagaataactcggtgggagctctatccgctcgcttatccggc
gaggcagttgatatccaaggagccataggatatcccttgagtggcatgattcaagcgttg
tccaacttcatttcaagtgtcagcgtagccatgtactacaactggaagttggccctttta
tgtttggccaattgtcccattatagtgggatctgtaatcctagaagctaagatgatgtct
aacgctgtagtgagggaaaagcaggtgattgaggaagcctgtcgcattgccaccgaatcc
attaccaacatacgcactgttgccggtctgcgaagggaggcggatgttatccgggagtac
acagaggagatccagcgggtggaggtgctcatccgccagaagcttagatggcgaggagtc
ctcaactccaccatgcaggcatcagctttcttcgcgtatgcagtggctctttgttacgga
ggtgttttggtgtccgagggtcagctgccattccaagatattatcaaggtatcagaaaca
ttgctgtatggttccatgatgctcgctcaatctctagcctttacgccggccttctccgcc
gctctgatcgcgggtcatcgcctattccaaatactggatcgcaagccaaagattcagtca
cccatgggcaccattaaaaatactctcgccaagcaattaaatcttttcgagggtgtgcgc
tatcgaggtattcaattccggtaccctacacgacctgatgcaaagattctgaatggcttg
gatcttgaggtgctcaagggtcaaacggtggccttggtgggtcattccgggtgtggaaaa
tccacttgcgttcagctacttcagcgttactatgatcccgatgagggcactattcatata
gatcacgatgatatccaacacgatctgaccctcgatggagtaaggaccaaattgggcata
gtctctcaagaacccactctcttcgagcgctctatagccgaaaatatagcctatggcgac
aatcggcgatctgtttccatggtggagattattgcagcagccaagagtgccaatgctcat
agttttatcatttctctaccaaatggctatgatactcggatgggagccagaggtactcag
ctatctggtggacagaaacagcgaatcgccattgccagagcgctggtgaggaatcccaag
atcctgctactcgacgaagccacctcagctttggacttgcaaagcgaacagttggtccaa
caggccttggataccgcctgctcgggacgcacctgtattgtcatagcccatcgattgtca
actgtccagaatgccgatgtgatctgtgtgattcaaaatggtcaggtggtggagcagggt
aaccacatgcagttgatttcacagggcggcatttacgccaagctacacaagacccaaaag
gatcattga

DBGET integrated database retrieval system