KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10335Help
Entry
Dmel_CG10335      CDS       T00030                                 

Gene name
Pbgs
Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG10335 (Pbgs)
Enzymes [BR:dme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dmel_CG10335 (Pbgs)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG10335 (Pbgs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:69A4-69A4
AA seq 327 aa AA seqDB search
MERKLHSGMHHATLRQLQESGCEIAPHNLMYPVFIVSNDDDVQPIASMPGISRFGLNRLK
EHLEPLVAKGLSSVLLFGVVDPDMKDEQASNADSAKNPVVLALPKLREWFPDLLIACDVC
ICPYSSHGHCGLLGETGLENGPSIKRIAEIAVAYAKAGAHIVAPSDMMDNRVKAIKQALI
DAQMNSVSLLAYSAKFTSNFYGPFREAAQSAPKFGDRRCYQLPSGSRSLAMRAIQRDVAE
GADMLMVKPGMPYLDILRSTKDSYPYHTLYVYQVSGEFAMLYHAAKAGAFDLKDAVLEAM
KGFRRAGADCIITYYTPFLLDIIGKVK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaaactgcacagtggaatgcaccatgccacgctgcggcagctgcaggagtcg
ggctgcgagatagcgccgcacaatctcatgtatccggtgttcatcgtgagcaacgacgac
gatgtccagccaattgccagcatgccaggaatctcgagattcggactgaatcgcctgaag
gagcacctggaaccgctggtggccaagggactgtcgtcggtgctgctctttggcgttgtg
gacccggacatgaaggatgagcaggcctccaatgcggattcagcaaagaatccagtcgtt
ctcgcactgccgaagctccgggaatggtttccggatctgctgatagcctgtgatgtgtgc
atctgcccgtactcctcgcacggtcactgcggcctgctgggcgaaacgggtctggagaac
ggacccagcataaagcggatagccgagatcgccgtggcttatgccaaagctggagcacac
attgtggctccatcggacatgatggacaaccgggtgaaggccattaagcaggccctcatc
gatgcccagatgaacagtgtatccctgctggcgtactccgccaagttcacatccaatttc
tatggacccttccgggaggcagcacaatctgcaccgaaattcggtgaccggaggtgctat
caactgcccagtggctccagaagcttagcaatgagagccattcaacgtgatgtcgccgag
ggagccgacatgctgatggtgaaaccgggaatgccctatctggatatcctacgatccaca
aaggattcctatccgtatcacacgctgtacgtctaccaggtttccggggagttcgctatg
ctgtatcatgccgccaaggcgggagcctttgacctcaaggatgccgtgctggaggccatg
aagggctttcgacgagctggtgccgattgcatcatcacctactacacaccctttctgctg
gacattatcggaaaggtcaagtaa

DBGET integrated database retrieval system