KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10418Help
Entry
Dmel_CG10418      CDS       T00030                                 

Gene name
CG10418
Definition
(RefSeq) uncharacterized protein
  KO
K12621  
U6 snRNA-associated Sm-like protein LSm2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    Dmel_CG10418 (CG10418)
  Folding, sorting and degradation
   03018 RNA degradation
    Dmel_CG10418 (CG10418)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     Dmel_CG10418 (CG10418)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     Dmel_CG10418 (CG10418)
Spliceosome [BR:dme03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    Dmel_CG10418 (CG10418)
 Complex C
  U2 snRNP components
    Dmel_CG10418 (CG10418)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 95 aa AA seqDB search
MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNC
FIRGSVVRYVQLPGDEVDTQLLQDAARKEAVVSTR
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgctcttttactccttcttcaagtcgctggtgggcaaggaagtcgttgtggagttgaaa
aacgacctcagcatatgtggcaccctgcactcggtggatcagtacctgaacatcaagctg
acggatatcagtgtcacagatccggacaagtacccccacatgctgagcgtcaagaactgc
ttcatccgtggctccgtggtgcgatacgtgcagctgccgggcgacgaggtggacacccag
ctgctccaggatgcggcgcgaaaggaggctgttgtgagcacaagataa

DBGET integrated database retrieval system