KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10467Help
Entry
Dmel_CG10467      CDS       T00030                                 

Definition
CG10467 gene product from transcript CG10467-RA (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG10467
   00052 Galactose metabolism
    Dmel_CG10467
Enzymes [BR:dme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dmel_CG10467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:65A6-65A6
AA seq 364 aa AA seqDB search
MVNVTEDVFANGAVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIKTPDASGQIDD
VTLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGKLVQVSKNRDNKFQLHGGFVG
FDKAHWEVVEVRVDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVQMSALADKTTP
VNLTNHSYFNLAGHKSGANGLYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSS
NLGERLKALQPARGYDDNFCVTFSPPQPLAKVARATHPPSGRWLEVVSNQPGVQFYTSNF
MPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGESYQHEVIYKF
GVSH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacgtcacggaagacgtcttcgccaacggagcggtgaatccgttcaccaagtca
aaggacaccatcaagcggttcaccctgacaaatggagctggaatgtccgtgcaattgatc
acccgtggagccaccattaccagcataaagacgcctgatgccagcggtcaaatagatgac
gtgaccctcggatttgacgatttggcgggctatcagagcgagagaaatccgtattttgga
gcaaccattgggcgggtttgcaaccggattgccaatggcagcttttatcttgatggaaag
ctagttcaggtgtctaagaaccgagacaacaagtttcagctccatggcggctttgtaggc
ttcgataaggctcactgggaagttgtggaagtgcgtgtggatggtgttaccctgtcccac
accaatcccgatggacacgaaggctatcccggcaaggtgacagccacggcaagctttacc
ctcagcgaggataactgcctccatgtccagatgagtgcactagcagataaaaccactccc
gtgaatctcaccaaccactcctatttcaacctagctggccacaaatctggagccaacggt
ctctacgagcacaccatcgagataaatgcttatggaatcactgagacggatcagtcttcc
attcccaccggccgtatcacacccgtagagggaacaggatttgatttacgtgtgtccagc
aatctgggtgaacgcctcaaggcgctgcagccagctcgcggctacgatgacaacttctgt
gtgaccttcagtccaccacaaccattggccaaggtggccagagccactcatccgcccagc
ggacgctggctggaggtggtcagcaatcagcccggagtgcagttctacacctccaacttt
atgccagacgtggaacgcggtgaatcgcccattcccggcaaggatggagctgcctatgcc
aagcattgtgccttctgcctggagacacaaaagtttcccgactccgtgaaccacagcaac
tttccctcgaccattttgcgacctggcgaaagttaccagcacgaagtcatctacaagttc
ggagtttctcactga

DBGET integrated database retrieval system