KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10757Help
Entry
Dmel_CG10757      CDS       T00030                                 

Gene name
mRpS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Ribosome [BR:dme03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dmel_CG10757 (mRpS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:38B6-38B6
AA seq 204 aa AA seqDB search
MLPIARGIYIGLVNITRNSRGALHTASALRCKAETSTEENNAAATEGEGEDNASGSAPDP
KDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYSEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtggaatttacattggactggtcaacattacccggaatagccgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagacttcgactgaagaaaat
aatgcggctgccaccgaaggcgaaggcgaggataacgctagtggttccgcaccagacccg
aaggatcgcagcaaaccaatcccagtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgaaagacgtgcatccgccagaaccgtatcagcaccgga
aatccctgtcccatttgccgtgatgaatacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtccttagctactcaaagacaggcctg
tgtcaaaagagccacctgcgtctaatggtcgccgttcagcaagcccgcgactccgggtac
ctaacatacgatgtgcccttcagggagtatgattacagcgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system