KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10757Help
Entry
Dmel_CG10757      CDS       T00030                                 

Gene name
mRpS18B
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:38B6-38B6
AA seq 204 aa AA seqDB search
MLPIARGIYIGLVNITRNSRGALHTASALRCKAETSTEENNAAATEGEGEDNASGSAPDP
KDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYSEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtggaatttacattggactggtcaacattacccggaatagccgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagacttcgactgaagaaaat
aatgcggctgccaccgaaggcgaaggcgaggataacgctagtggttccgcaccagacccg
aaggatcgcagcaaaccaatcccagtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgaaagacgtgcatccgccagaaccgtatcagcaccgga
aatccctgtcccatttgccgtgatgaatacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtccttagctactcaaagacaggcctg
tgtcaaaagagccacctgcgtctaatggtcgccgttcagcaagcccgcgactccgggtac
ctaacatacgatgtgcccttcagggagtatgattacagcgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system