KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10811Help
Entry
Dmel_CG10811      CDS       T00030                                 

Gene name
eIF4G
Definition
(RefSeq) eukaryotic translation initiation factor 4G, isoform B
  KO
K03260  
translation initiation factor 4G
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG10811 (eIF4G)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG10811 (eIF4G)
   mRNA cycle factors
    Stress granule specific factors
     Dmel_CG10811 (eIF4G)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmel_CG10811 (eIF4G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
4
AA seq 1919 aa AA seqDB search
MQQAIPTLPTQSDIDKAMQPHSAQNMILPANKKTKKYDQQVPTSKPQSLHQPLQPQHSHP
TAQPQFQINKAYNVVSILKASAQIAQQSPHLTNQQHPPIHHPQQTQQHQQSYTNVVNRSL
SASEPVRAQSSVICNGSSILTVNSRQLNSGDMNSTAIYNISSYRKLTGSLDGNVCFLNVQ
DIKQNGNISGSVVSNKSIVGVGSEKSSCTGVSINNQIVLPNAQIGTSMGIAGTTTAGTSY
MHEKNIVGVSVNCVNTSKKYDFNNSSLLSNNSYPASTAEYVSTGNNNSGNTRSNPQSGGI
FRGPPSTPNAPRGASGGATRHVHVQPMYSQPLHQNMVLQQYTQYNPRQQTFPASHLQYAP
APMPYYQYQYVPTLQQQPPHTRSAVTVNTNVNVGNNLQPVQSGPNGPLPVPGASSSQIQL
LTSTVQPGASTVMGVGGPGSTMGQVGVPPMVGVGVMTTSVQPQPVQVQPASRRRHQHRLQ
IIDPTTKKNILDDFDKTKSNTDNEFSDQVTSTNTPATVLSEGPIRIPQQESVGLNNLTST
SSQGSESRTNAPYIPIETTPISRTDVGPTPIVSAMTDAPSVEILPTPQRGRSKKIPIVSP
KNVSESIVAPITDETDDAGSTPISRATEESMPPNQTHPNLLISDSSKHKQAVSNSEISKD
APTGLKEMHVAELESSVASENHPAGILDVNVNKSSQSLDFSADPEIDSIGAISPTSPNAV
SPILHEVLDNTELSKKLENSTTERFKDSQSVEKPTHQELSLRNATDETEISAMALQDVNS
LDNNQIEKTYPSKPKLNVDVSEDISSRESAIKSTSTKNTGVDVGLQSDSKPETTLNDKQD
STDLKVKVSAKISSIINYNEGQWSPNNPSGKKQYDREQLLQLREVKASRIQPEVKNVSIL
PQPNLMPSFIRNNNNNKRVQSMVGIIGNRSNESAGNYIGKQMSMSGVQSGGGRSSMKGMI
HVNLSLNQDVKLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDT
LVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETK
SNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEER
KIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDMLECLCKLLTTVGAKFEKT
PVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQTSRNEA
PKTMGQIEKEAKNEQLSAQYFGTLSSTTPGGSQGGSGKRDDRGNSRYGESRSSSAYGGSH
SQRGDNGNLRHQQQNNVGGNVSGGAGHSNGNNDENTWHVQTSKGSRSLAVDSNKLEGLSK
LSDQNLETKKMGGLTQFIWISSDTTRLSSAPTPTPSNPFAVLSSLIDKNSNERDRDRSGP
RNKGSYNKGSMERDRYDRGMHSRTGSSQGSRENSSSRGGQQGRTLLSSSVQKSTSHSKYT
QQAPPTRHTVKAQSSVGSSNVNTGPLYRGSEQQTSATFSQTTRSVAPVAVFIEASETDLK
LIKSVVSEIVDLSAASKEVTPGAVSCIKRVPEKLRCSFIYYILTDYLHLANVGKQYRRYL
SIAVSQLIQQNYISADHLRLAYNEFTVYANDLIVDIPELWLYILQFAGPLIVKKILTISD
LWNNNLKENSPSNVAKKFLKTYLIYCTQEVGPNFARNMWIKFNLKWSDFMPESEVADFIK
FNRLEYVENESKSPVIDHRETPEKHVKNVIDHIEHLLKEGTTADCIIDYSNGNIMVVDKL
FIRGLTETLSNFSIHYKDNSYKLESETFQKFCIPVLQRYIDSNEDHQLECLYTLQLLVHG
LEHPRGLLSELIGELYDAFVIQKESLCKWRDSKDQSAGKGVAVKSLNPFFNSLLNDDAN
NT seq 5760 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggctataccaactttaccaacacaatcagatatagataaagccatgcagccc
cattcagcacaaaatatgattttgccagccaataaaaagaccaaaaagtatgatcaacag
gtgccaacttcaaagccacaatctcttcatcagcctcttcaaccgcagcatagccatccc
actgctcagcctcagtttcagataaataaggcatacaatgtggtctccattcttaaggca
tcagcgcagatcgctcaacagtccccacacttgacgaatcagcagcatccaccaatccat
cacccacagcaaacacagcagcatcaacaaagctatacaaacgttgtaaatagaagctta
tctgcgtctgaaccagttagagcccagtcatcggttatctgtaacggttcaagcatattg
acagtaaatagtagacaactgaattcgggtgatatgaattcgactgccatttataacata
tccagttaccgaaaattaactggaagtctagatggaaatgtttgctttctaaatgtacag
gacattaaacaaaatggcaacatcagtgggtcagtagtatcaaataagtccatcgtcgga
gtcggaagtgaaaaaagttcttgtactggagtcagtattaacaaccaaatagtattgcct
aatgcgcaaataggaacatctatgggaatagctggaacaactacagcaggcacaagctac
atgcacgaaaagaatatcgttggcgttagcgtcaattgtgttaatactagtaaaaagtat
gatttcaataacagtagtttgttatcaaataatagttacccggcatctacagcagagtat
gtatcaacgggaaacaacaattctgggaatacccgttctaatccacaaagtggcggaata
tttcgaggaccaccctcgacgcctaatgcccctagaggtgctagtggcggagcaacacgg
catgtccatgtgcaacccatgtactcacaaccccttcaccagaacatggtgctacaacaa
tacacacaatataacccacggcaacaaacatttccagcttctcatttgcaatacgcaccc
gcccccatgccatactaccagtaccaatatgtcccaactcttcagcaacagccgccgcat
actcgtagtgctgtcacggtaaatacgaacgtcaatgtgggaaacaatttgcagccagtg
cagtctggacccaatggacctctccctgttccgggggctagctcgtcgcaaattcaattg
ctcacaagcacagtgcagccaggagccagcactgtaatgggcgttggcggtcctggtagt
acaatggggcaagtgggtgtgccaccaatggttggggttggtgtaatgacaacaagtgtg
caaccgcaacctgtgcaggtgcagcctgctagccggcgccggcatcagcatcgattgcag
ataatcgatccgacgactaaaaaaaatattttagacgattttgataagacaaaatcaaac
acagacaatgaattttccgatcaggtaacctccacaaacacaccagcaactgtcctttca
gaaggtccaatacgtattccacagcaagaaagtgttggtttaaataatttgaccagtaca
tcatcacaaggatcagaatcacggacaaacgcgccttatatccccattgaaacaacacca
ataagtcgaacagatgttgggccgactccaatcgtatccgcgatgactgatgctccttcg
gttgaaatattaccaacgccccaaagagggagaagcaaaaaaattcctatagtgtctcct
aaaaatgtatctgagtccatagttgctcctatcactgatgaaacggatgatgcagggtca
acaccgatatccagagccactgaagaatctatgccacctaatcagacccatccaaattta
ctcatatccgattcatcaaaacataagcaagcagtatcaaatagtgagatttcaaaagac
gctcctactggtttaaaggaaatgcatgttgctgagctggagtccagtgtagcctccgaa
aatcatccagctggaatactagatgtcaatgtcaacaagagttcacaatcattggatttt
tctgcagatcccgaaattgatagtattggcgcaatatcacctacgagtccaaacgcagtt
tctcctattttacacgaagttttagataatactgagttgtcaaaaaaattagagaattct
acgacagaaagatttaaagatagccaaagcgtagagaagccaactcatcaagaactaagt
ttaagaaatgccacagacgagactgaaatatccgcaatggcattacaagatgtgaatagt
ttggataataaccaaattgaaaaaacatacccttcaaagccgaaactcaatgtagatgtt
tcagaagacatttcctccagagagtcagcaataaagtcaacttctacaaaaaatacagga
gtagatgtaggtctccaatcagattctaagccagagactacccttaacgataaacaggac
tctactgacctaaaagtgaaagtgtctgcgaaaatttcatctatcataaactataatgag
ggtcaatggtcaccaaacaatccaagcggaaaaaaacaatacgaccgagaacagttatta
cagttacgcgaggttaaggcctcacgtatacaaccagaggtaaaaaatgtgtctattctt
cctcaaccaaacttaatgccatcatttattcgaaataacaataataacaagcgagtacaa
tcgatggttggtattattggcaatcgtagcaatgaatcggcgggaaattatattggtaaa
cagatgtcgatgtctggcgtacaaagtggcggcggtagaagcagtatgaagggcatgata
cacgtaaatttatcattaaatcaagatgtaaagttaagtgaaaatgaaaatgcatggcgc
cctcgggtcttaaataaatctgatggtgatagcgacgcgaaatctgcactcgaaaaagat
gaattggtacgtcgtgttcggggtattttaaataagcttaccccagaaaggtttgacaca
cttgttgaggagattataaaattgaaaattgatacacccgacaaagtggacgaagtaatt
gtgttggtatttgaaaaggccattgatgagccaaacttttctgtgtcttacgccagacta
tgtcaacgacttgctgcggaagtgaaggtaatagacgagcgcatggaaagcgaaaccaaa
tctaactcggcacactttcgaaatgcattgttagataaaactgaacaggaattcacccaa
aacgtttcacaaagcaccgcaaaggaaaaaaaattacagccaattgtggataaaattaag
aaatgtactgatgccaatgaaaaagcggaacttgaggcatttttggaagaagaagaaaga
aaaataagaagacgatccggagggacagtacgatttattggcgaactttttaagatatct
atgttgactggcaaaataatatactcttgcatcgatacacttcttaaccctcattctgaa
gacatgcttgagtgtttgtgcaagctgcttacaactgtgggtgctaaatttgaaaagacc
ccagtaaattccaaagaccctagtcggtgttattcgttggaaaaatcgatcaccaggatg
caggccatcgcatcgaaaactgacaaagatggagccagagtaagctcaagagtacgattt
atgcttcaagacgttatcgacttgcgtaagaataaatggcaaacttcgcggaatgaagca
cccaaaactatgggacaaattgaaaaagaggcaaagaatgagcagctttctgcacaatat
tttggtacactttccagtactacacccggaggatcgcagggcggctctggtaaacgagat
gaccgtggaaactctcgatacggtgaatctcgttcaagtagcgcgtatggtggcagccac
agtcaacgtggtgataatggcaaccttcgacaccagcagcagaacaacgtcgggggaaac
gtctctggaggtgctggacactccaatggaaacaatgatgaaaatacttggcatgtgcaa
accagcaaaggtagccgctctctagcggttgacagcaataaactggaaggcctgtctaaa
ctttctgaccaaaatctggaaacaaagaagatgggtggattaacgcaattcatttggatt
agtagtgacacgacaagactatcgtcggcgccgacaccaaccccatccaatcctttcgct
gtgctctcatccctaattgataaaaatagtaatgaaagggatcgcgatcgcagtggaccc
agaaacaaaggatcatacaacaaaggttctatggagcgggatcgttatgatagaggtatg
cattcgagaactggatcatctcagggatcacgagaaaactcatcctcccgcggtggtcag
cagggtcgaactttattgagttcatcagttcaaaaatctactagtcattcaaaatacacc
caacaggcaccacctacacggcatactgttaaagcccagtcatcagtgggcagctctaac
gttaacacaggtccactctaccgtggaagtgagcagcaaacatcagcaaccttctcgcag
accacccgttctgttgctcctgtagcagtgttcatcgaagctagcgaaacagatttaaaa
ctcatcaaatctgttgtttcagaaattgtagacctatcagctgcatctaaagaagtcacg
cccggtgcagtttcgtgcataaaacgagtaccagagaaactacggtgcagtttcatttat
tatattttaacagattatttgcatttagcaaatgtaggtaaacagtacaggcggtattta
tctattgccgtctcccaacttattcagcagaattacatttctgccgatcatttgagactg
gcttacaacgaatttaccgtatatgcaaacgatttgattgttgatattccggagctttgg
ctatacattcttcaatttgccgggccactaattgtaaagaaaatattgactatatcagat
ttgtggaacaacaatttaaaagaaaatagtccatcaaacgtcgctaaaaagttccttaaa
acatacttgatatattgcacacaagaagttggaccaaattttgctcggaatatgtggatc
aagtttaacctaaaatggtcagattttatgcctgaaagtgaagttgccgactttattaaa
tttaacagactggaatatgtggaaaacgaatcaaagtcgccagtgattgatcatagagag
actccagaaaagcacgttaaaaatgtgatagaccatattgagcacttactaaaggaagga
acaacggcggactgcattattgattatagtaacggaaatataatggtggttgataagttg
tttatcagaggattgacggaaacattgagtaatttctcgattcactacaaggacaacagt
tacaagcttgagtccgaaacctttcaaaagttttgcataccggttttgcagagatacatt
gattctaatgaagaccaccaacttgaatgtttatatactttgcagcttttagttcatgga
ttggagcatccaagagggttgctgagtgaactaattggcgagctatatgatgcctttgta
atacagaaggaatcgctttgtaagtggcgagattcaaaggatcagtctgctggcaagggc
gttgctgtaaaaagtcttaatcctttttttaactcgttgttaaacgatgatgccaactaa

DBGET integrated database retrieval system