KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10811Help
Entry
Dmel_CG10811      CDS       T00030                                 

Gene name
eIF4G
Definition
eukaryotic translation initiation factor 4G
Orthology
K03260  
translation initiation factor 4G
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dme03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4:102F1-102F1
AA seq 1919 aa AA seqDB search
MQQAIPTLPTQSDIDKAMQPHSAQNMILPANKKTKKYDQQVPTSKPQSLHQPLQPQHSHP
TAQPQFQINKAYNVVSILKASAQIAQQSPHLTNQQHPPIHHPQQTQQHQQSYTNVVNRSL
SASEPVRAQSSVICNGSSILTVNSRQLNSGDMNSTAIYNISSYRKLTGSLDGNVCFLNVQ
DIKQNGNISGSVVSNKSIVGVGSEKSSCTGVSINNQIVLPNAQIGTSMGIAGTTTAGTSY
MHEKNIVGVSVNCVNTSKKYDFNNSSLLSNNSYPASTAEYVSTGNNNSGNTRSNPQSGGI
FRGPPSTPNAPRGASGGATRHVHVQPMYSQPLHQNMVLQQYTQYNPRQQTFPASHLQYAP
APMPYYQYQYVPTLQQQPPHTRSAVTVNTNVNVGNNLQPVQSGPNGPLPVPGASSSQIQL
LTSTVQPGASTVMGVGGPGSTMGQVGVPPMVGVGVMTTSVQPQPVQVQPASRRRHQHRLQ
IIDPTTKKNILDDFDKTKSNTDNEFSDQVTSTNTPATVLSEGPIRIPQQESVGLNNLTST
SSQGSESRTNAPYIPIETTPISRTDVGPTPIVSAMTDAPSVEILPTPQRGRSKKIPIVSP
KNVSESIVAPITDETDDAGSTPISRATEESMPPNQTHPNLLISDSSKHKQAVSNSEISKD
APTGLKEMHVAELESSVASENHPAGILDVNVNKSSQSLDFSADPEIDSIGAISPTSPNAV
SPILHEVLDNTELSKKLENSTTERFKDSQSVEKPTHQELSLRNATDETEISAMALQDVNS
LDNNQIEKTYPSKPKLNVDVSEDISSRESAIKSTSTKNTGVDVGLQSDSKPETTLNDKQD
STDLKVKVSAKISSIINYNEGQWSPNNPSGKKQYDREQLLQLREVKASRIQPEVKNVSIL
PQPNLMPSFIRNNNNNKRVQSMVGIIGNRSNESAGNYIGKQMSMSGVQSGGGRSSMKGMI
HVNLSLNQDVKLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDT
LVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETK
SNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEER
KIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDMLECLCKLLTTVGAKFEKT
PVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQTSRNEA
PKTMGQIEKEAKNEQLSAQYFGTLSSTTPGGSQGGSGKRDDRGNSRYGESRSSSAYGGSH
SQRGDNGNLRHQQQNNVGGNVSGGAGHSNGNNDENTWHVQTSKGSRSLAVDSNKLEGLSK
LSDQNLETKKMGGLTQFIWISSDTTRLSSAPTPTPSNPFAVLSSLIDKNSNERDRDRSGP
RNKGSYNKGSMERDRYDRGMHSRTGSSQGSRENSSSRGGQQGRTLLSSSVQKSTSHSKYT
QQAPPTRHTVKAQSSVGSSNVNTGPLYRGSEQQTSATFSQTTRSVAPVAVFIEASETDLK
LIKSVVSEIVDLSAASKEVTPGAVSCIKRVPEKLRCSFIYYILTDYLHLANVGKQYRRYL
SIAVSQLIQQNYISADHLRLAYNEFTVYANDLIVDIPELWLYILQFAGPLIVKKILTISD
LWNNNLKENSPSNVAKKFLKTYLIYCTQEVGPNFARNMWIKFNLKWSDFMPESEVADFIK
FNRLEYVENESKSPVIDHRETPEKHVKNVIDHIEHLLKEGTTADCIIDYSNGNIMVVDKL
FIRGLTETLSNFSIHYKDNSYKLESETFQKFCIPVLQRYIDSNEDHQLECLYTLQLLVHG
LEHPRGLLSELIGELYDAFVIQKESLCKWRDSKDQSAGKGVAVKSLNPFFNSLLNDDAN
NT seq 5760 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggctataccaactttaccaacacaatcagatatagataaagccatgcagccc
cattcagcacaaaatatgattttgccagccaataaaaagaccaaaaagtatgatcaacag
gtgccaacttcaaagccacaatctcttcatcagcctcttcaaccgcagcatagccatccc
actgctcagcctcagtttcagataaataaggcatacaatgtggtctccattcttaaggca
tcagcgcagatcgctcaacagtccccacacttgacgaatcagcagcatccaccaatccat
cacccacagcaaacacagcagcatcaacaaagctatacaaacgttgtaaatagaagctta
tctgcgtctgaaccagttagagcccagtcatcggttatctgtaacggttcaagcatattg
acagtaaatagtagacaactgaattcgggtgatatgaattcgactgccatttataacata
tccagttaccgaaaattaactggaagtctagatggaaatgtttgctttctaaatgtacag
gacattaaacaaaatggcaacatcagtgggtcagtagtatcaaataagtccatcgtcgga
gtcggaagtgaaaaaagttcttgtactggagtcagtattaacaaccaaatagtattgcct
aatgcgcaaataggaacatctatgggaatagctggaacaactacagcaggcacaagctac
atgcacgaaaagaatatcgttggcgttagcgtcaattgtgttaatactagtaaaaagtat
gatttcaataacagtagtttgttatcaaataatagttacccggcatctacagcagagtat
gtatcaacgggaaacaacaattctgggaatacccgttctaatccacaaagtggcggaata
tttcgaggaccaccctcgacgcctaatgcccctagaggtgctagtggcggagcaacacgg
catgtccatgtgcaacccatgtactcacaaccccttcaccagaacatggtgctacaacaa
tacacacaatataacccacggcaacaaacatttccagcttctcatttgcaatacgcaccc
gcccccatgccatactaccagtaccaatatgtcccaactcttcagcaacagccgccgcat
actcgtagtgctgtcacggtaaatacgaacgtcaatgtgggaaacaatttgcagccagtg
cagtctggacccaatggacctctccctgttccgggggctagctcgtcgcaaattcaattg
ctcacaagcacagtgcagccaggagccagcactgtaatgggcgttggcggtcctggtagt
acaatggggcaagtgggtgtgccaccaatggttggggttggtgtaatgacaacaagtgtg
caaccgcaacctgtgcaggtgcagcctgctagccggcgccggcatcagcatcgattgcag
ataatcgatccgacgactaaaaaaaatattttagacgattttgataagacaaaatcaaac
acagacaatgaattttccgatcaggtaacctccacaaacacaccagcaactgtcctttca
gaaggtccaatacgtattccacagcaagaaagtgttggtttaaataatttgaccagtaca
tcatcacaaggatcagaatcacggacaaacgcgccttatatccccattgaaacaacacca
ataagtcgaacagatgttgggccgactccaatcgtatccgcgatgactgatgctccttcg
gttgaaatattaccaacgccccaaagagggagaagcaaaaaaattcctatagtgtctcct
aaaaatgtatctgagtccatagttgctcctatcactgatgaaacggatgatgcagggtca
acaccgatatccagagccactgaagaatctatgccacctaatcagacccatccaaattta
ctcatatccgattcatcaaaacataagcaagcagtatcaaatagtgagatttcaaaagac
gctcctactggtttaaaggaaatgcatgttgctgagctggagtccagtgtagcctccgaa
aatcatccagctggaatactagatgtcaatgtcaacaagagttcacaatcattggatttt
tctgcagatcccgaaattgatagtattggcgcaatatcacctacgagtccaaacgcagtt
tctcctattttacacgaagttttagataatactgagttgtcaaaaaaattagagaattct
acgacagaaagatttaaagatagccaaagcgtagagaagccaactcatcaagaactaagt
ttaagaaatgccacagacgagactgaaatatccgcaatggcattacaagatgtgaatagt
ttggataataaccaaattgaaaaaacatacccttcaaagccgaaactcaatgtagatgtt
tcagaagacatttcctccagagagtcagcaataaagtcaacttctacaaaaaatacagga
gtagatgtaggtctccaatcagattctaagccagagactacccttaacgataaacaggac
tctactgacctaaaagtgaaagtgtctgcgaaaatttcatctatcataaactataatgag
ggtcaatggtcaccaaacaatccaagcggaaaaaaacaatacgaccgagaacagttatta
cagttacgcgaggttaaggcctcacgtatacaaccagaggtaaaaaatgtgtctattctt
cctcaaccaaacttaatgccatcatttattcgaaataacaataataacaagcgagtacaa
tcgatggttggtattattggcaatcgtagcaatgaatcggcgggaaattatattggtaaa
cagatgtcgatgtctggcgtacaaagtggcggcggtagaagcagtatgaagggcatgata
cacgtaaatttatcattaaatcaagatgtaaagttaagtgaaaatgaaaatgcatggcgc
cctcgggtcttaaataaatctgatggtgatagcgacgcgaaatctgcactcgaaaaagat
gaattggtacgtcgtgttcggggtattttaaataagcttaccccagaaaggtttgacaca
cttgttgaggagattataaaattgaaaattgatacacccgacaaagtggacgaagtaatt
gtgttggtatttgaaaaggccattgatgagccaaacttttctgtgtcttacgccagacta
tgtcaacgacttgctgcggaagtgaaggtaatagacgagcgcatggaaagcgaaaccaaa
tctaactcggcacactttcgaaatgcattgttagataaaactgaacaggaattcacccaa
aacgtttcacaaagcaccgcaaaggaaaaaaaattacagccaattgtggataaaattaag
aaatgtactgatgccaatgaaaaagcggaacttgaggcatttttggaagaagaagaaaga
aaaataagaagacgatccggagggacagtacgatttattggcgaactttttaagatatct
atgttgactggcaaaataatatactcttgcatcgatacacttcttaaccctcattctgaa
gacatgcttgagtgtttgtgcaagctgcttacaactgtgggtgctaaatttgaaaagacc
ccagtaaattccaaagaccctagtcggtgttattcgttggaaaaatcgatcaccaggatg
caggccatcgcatcgaaaactgacaaagatggagccagagtaagctcaagagtacgattt
atgcttcaagacgttatcgacttgcgtaagaataaatggcaaacttcgcggaatgaagca
cccaaaactatgggacaaattgaaaaagaggcaaagaatgagcagctttctgcacaatat
tttggtacactttccagtactacacccggaggatcgcagggcggctctggtaaacgagat
gaccgtggaaactctcgatacggtgaatctcgttcaagtagcgcgtatggtggcagccac
agtcaacgtggtgataatggcaaccttcgacaccagcagcagaacaacgtcgggggaaac
gtctctggaggtgctggacactccaatggaaacaatgatgaaaatacttggcatgtgcaa
accagcaaaggtagccgctctctagcggttgacagcaataaactggaaggcctgtctaaa
ctttctgaccaaaatctggaaacaaagaagatgggtggattaacgcaattcatttggatt
agtagtgacacgacaagactatcgtcggcgccgacaccaaccccatccaatcctttcgct
gtgctctcatccctaattgataaaaatagtaatgaaagggatcgcgatcgcagtggaccc
agaaacaaaggatcatacaacaaaggttctatggagcgggatcgttatgatagaggtatg
cattcgagaactggatcatctcagggatcacgagaaaactcatcctcccgcggtggtcag
cagggtcgaactttattgagttcatcagttcaaaaatctactagtcattcaaaatacacc
caacaggcaccacctacacggcatactgttaaagcccagtcatcagtgggcagctctaac
gttaacacaggtccactctaccgtggaagtgagcagcaaacatcagcaaccttctcgcag
accacccgttctgttgctcctgtagcagtgttcatcgaagctagcgaaacagatttaaaa
ctcatcaaatctgttgtttcagaaattgtagacctatcagctgcatctaaagaagtcacg
cccggtgcagtttcgtgcataaaacgagtaccagagaaactacggtgcagtttcatttat
tatattttaacagattatttgcatttagcaaatgtaggtaaacagtacaggcggtattta
tctattgccgtctcccaacttattcagcagaattacatttctgccgatcatttgagactg
gcttacaacgaatttaccgtatatgcaaacgatttgattgttgatattccggagctttgg
ctatacattcttcaatttgccgggccactaattgtaaagaaaatattgactatatcagat
ttgtggaacaacaatttaaaagaaaatagtccatcaaacgtcgctaaaaagttccttaaa
acatacttgatatattgcacacaagaagttggaccaaattttgctcggaatatgtggatc
aagtttaacctaaaatggtcagattttatgcctgaaagtgaagttgccgactttattaaa
tttaacagactggaatatgtggaaaacgaatcaaagtcgccagtgattgatcatagagag
actccagaaaagcacgttaaaaatgtgatagaccatattgagcacttactaaaggaagga
acaacggcggactgcattattgattatagtaacggaaatataatggtggttgataagttg
tttatcagaggattgacggaaacattgagtaatttctcgattcactacaaggacaacagt
tacaagcttgagtccgaaacctttcaaaagttttgcataccggttttgcagagatacatt
gattctaatgaagaccaccaacttgaatgtttatatactttgcagcttttagttcatgga
ttggagcatccaagagggttgctgagtgaactaattggcgagctatatgatgcctttgta
atacagaaggaatcgctttgtaagtggcgagattcaaaggatcagtctgctggcaagggc
gttgctgtaaaaagtcttaatcctttttttaactcgttgttaaacgatgatgccaactaa

DBGET integrated database retrieval system