KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10868Help
Entry
Dmel_CG10868      CDS       T00030                                 

Gene name
orb
Definition
oo18 RNA-binding protein
Orthology
K02602  
cytoplasmic polyadenylation element-binding protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG10868 (orb)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG10868 (orb)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     Dmel_CG10868 (orb)
   mRNA cycle factors
    P-body specific factors
     Dmel_CG10868 (orb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:94E9-94E9
AA seq 617 aa AA seqDB search
MDSINMFYNQQQQQQQPEQQGYTSLGNSMGSGLGLSLANASTRSNSPESQNSSNSTTEQN
LLDMINLLSVNSNKIPHQQQQQQQQQQQQQQQQQQNQQQLQVQQQHQLQQQFVNLNRNYE
QQISANLGSQQHGFEHNGVGVGASSSGNENCFSQYNLENITSVDMELAKLQNLQRINTLK
LLHAQAQQMPLINQLLQSYAGNAIGSVGGSNLGNLMSAGGSSLMTEMAGNVGGIITTNDG
HLDRVAKFYKSSAALCDATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKP
FGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSACVLQVDDSHCGRNYFFKISSRR
IKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAEGLGNIMDDLFDGVLYA
GIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIEIRTTKFTKKVQVDPYLEDALCSICGV
QHGPYYCRELSCFRYFCRSCWQWQHSCDIVKNHKPLTRNSKSQSLVGIGPSSSNVSLPFS
GQRSIRDNRMGNGQHQQHQQHQYQQQKHRQLQEYSQPHSLNVMGNSGAANAAATSMVTLQ
QRQIHKVRIQRQQHQAI
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggactccatcaacatgttctacaaccagcaacaacaacagcaacagccggagcagcaa
ggttacaccagtttgggcaactccatgggcagcggattgggacttagtttggcaaacgct
tccacgcgctcgaactcgccagagagtcagaacagcagcaattcaacgactgaacaaaat
ctactggacatgattaatttgctgtctgtaaatagcaacaaaattccacatcaacaacag
caacaacaacagcagcagcaacaacaacagcagcagcaacaacagaatcagcagcaattg
caggttcagcaacaacatcagttgcagcagcagtttgttaacctaaacaggaactacgag
caacagatatctgccaatttgggtagccaacaacatgggttcgagcacaacggcgtgggt
gtgggtgcttctagtagcggaaatgagaactgctttagccagtataatctagaaaacatc
accagtgtggacatggagctggccaaactgcagaatttgcaacgcatcaacacgctaaag
ctcctgcatgcccaagctcaacaaatgccgctgatcaaccagctcctgcagagctatgcc
ggcaacgccataggcagcgtcggtggaagcaatcttggtaacttgatgagcgcaggcgga
tcatcactgatgacagaaatggcgggaaacgttggcggcattataaccaccaacgatggc
cacctggatcgcgtagctaagttctataagagttcggctgccctgtgcgatgccacatgc
acatggagtggacacctgccgccgcgttcgcaccgtatgctcaactattctcccaaggtc
ttcctcggcgggattccctgggatattagtgagcagtcgctcatccagatcttcaagcca
tttggatctattaaagtggagtggcccggcaaggagcagcaggcggctcagcccaagggt
tatgtttacataatctttgaatcggacaagcaggtcaaggcattactttcggcctgtgtg
cttcaggtggatgattctcactgtggtaggaactacttcttcaaaatctcttcgcggcgt
attaagtccaaggatgttgaagtcattccttggattatcgctgactccaattttgtgcga
tccagctcccagaaacttgacccaacgaaaaccgtgtttgtgggcgcactgcatggaaaa
ctgactgccgagggcttgggaaatataatggatgatcttttcgacggcgtgctgtatgct
ggtatagatacggacaagtacaagtacccgatcggatcgggacgtgtgacatttagcaac
tttcgctcctatatgaaagctgtttcggccgcctttatcgagattaggaccacgaagttc
accaagaaggtgcaggtggatccctacttggaggatgccctatgttccatatgcggtgtg
cagcacggtccctactattgtagggaattatcgtgcttccgatacttctgccgcagctgc
tggcaatggcagcacagctgtgacatcgtcaaaaatcacaagcccttgactcgcaactcc
aagtcgcagagcctggttggcatcggaccatcttcgtcgaatgtttcgttacccttctct
ggccaacgaagtatcagggacaacagaatggggaacggtcagcatcaacagcaccagcag
catcagtaccaacagcagaaacaccgtcagctgcaagaatactcgcagccccacagtctc
aacgtgatgggaaactcaggagctgccaatgccgctgctacatcaatggtaactcttcag
cagcggcaaattcacaaggtgcgaatacagcgtcaacagcatcaggcgatctag

DBGET integrated database retrieval system