KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1107Help
Entry
Dmel_CG1107       CDS       T00030                                 

Gene name
aux
Definition
auxillin (EC:2.7.11.-)
Orthology
K08855  
cyclin G-associated kinase [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:82A1-82A1
AA seq 1153 aa AA seqDB search
MGEFFKSLNLNYFSSSEVNGAAGNGAPEALGGRLDNDFVGQVVEVAGHRLRIKCVIAEGG
YAFVYVAQDVQTGTEYALKRLIGADMQASTAIINEINIHKQLSGHENIVAFVGSSYTAPS
TQLGAQYLLLTELCKGGSLVDCFRTNNAPFNPTCVLRIFYQMARAVASLHSQSPPIAHRD
IKIENFLIGNDKQIKLCDFGSASTEVLSPTFEWSANQRSMLEDQLNTVTTPMYRSPEMLD
TWSNNPIGPKVDIWALGCILYFLCYRKHPYEDGGKLRIINANYMLPPDPQYQCFSDIIRG
CLKVNPFERLDITMVLEGLAALAETHNWSLKGPLDLHIMPIESLPAESPLKSSAYSEVYT
EPLSAAIPSSYNGHGSLLSSLRGGAGTLLKNIKDTSTKVMQTMQQSLARNDLDISHITSR
ILVMPCPSDGFESTYKTNNIEDVRLSLESRFVPQKLSIYNFGQRTEPRLPPPVRTVEAGS
VYGCPQAHAPNLQGLFTVSADMYNFLNADPKSVVIVQTGDSGGCTAATVICALLMYADLL
REPEDAVQVFAVKRHTINLRPSEFRYLYYFGDILRPTPLLPHYKNTTLVSLSCQPVPRMT
KARDGCRIYMEVYCNGNLLLSTLQDYEKMRLYQAGPGKIVLPINLTACGDVTVVLFHARK
GMVRPQGLKICQFQFNTGFIPEPETLITFTNQDLDDLPDPEQVTPRFCVSLSLAVTDSES
PPSHKPPWMPAKPKRSPAALFSSDLEYAEMLDNFGARKSDRVSSPLVLPDVTETAHELPS
PMPEPSPPIDLLNLNQQPSDVPAADPLTSAKPSTDASFDLLGAFGDDDSTGIGSAPIPDI
LPPPPLQQPQPKINNDPFDIFGSVDQGGVPSMKPSGFPPFVGSLPTFVAQPAATTNPSPT
HPARASADPFANIADLATGLNLNFNRSTLSGKSPVNTSPQPTQFSSPTHKPSPSSQPQAT
FMHTPPTPQTLPSTSSIRTPTQPQAVPAQSRPDYSRLHFDSQKAAQQPGTGGSKNSDIFA
DILGQQGYSFGSKMNQCPRSINEMRKEDLFKDMDPKKVRIMEWTDGKKNNIRALLCSMHT
VLWDNAKWQRCEMSTMVTPTEVKKAYRRACLAVHPDKHNGTENEEIAKLIFMELNNAWTD
FENDATQQNMFNA
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagttctttaagtcgctcaacctcaactacttctcctctagcgaggtcaacgga
gctgcaggaaacggagcaccagaggccctcggtggcaggctggacaatgacttcgtgggc
caggtcgttgaagtcgctggacacaggctgcgcatcaagtgtgtcatcgccgaaggcgga
tacgccttcgtgtatgtagcccaagatgtgcaaactggcacagaatacgccctcaagcgt
ctgatcggggctgacatgcaagcctccaccgccatcatcaacgagatcaacatccacaag
cagctgtcggggcacgagaacattgtcgcctttgtgggttccagttataccgccccatca
actcaattgggagcccagtacttgctcctcaccgagctgtgtaaaggcggatctctggtg
gactgcttcagaacaaacaatgctccattcaatccgacttgtgttctgcgcatcttctac
caaatggcgcgggctgtggccagcttgcactcacagtcaccgccgatagcccaccgagat
ataaagattgagaactttctcattggcaacgacaaacagatcaagctgtgcgactttggg
tccgccagcacggaggtcctgtcgcccacgtttgagtggagcgccaaccagcgcagcatg
ctggaggaccagctaaacactgttactactccgatgtaccgatcccctgagatgctcgac
acttggtccaacaacccgattgggcccaaagtggacatatgggctctcggatgcattctc
tacttcctgtgctaccgcaagcatccctacgaggatggcggaaagctgcggatcattaac
gccaattacatgcttccgccagatcctcagtaccagtgcttcagcgatataatccgtggc
tgtttaaaagtgaacccgttcgagcgcctggatattactatggtgctggagggccttgca
gccctcgctgagacacacaattggtcgctcaaaggacctctagaccttcatataatgccc
atcgagtcccttccggccgaaagtcctctcaaaagttctgcttactctgaggtttacacc
gaaccgctttctgccgccataccatcatcttataatggacacggcagtcttctgtcgtca
ctgcgtggtggcgctggaacgcttttaaagaacattaaagatacgtccaccaaagtgatg
caaacaatgcagcaatctcttgctcgcaacgatcttgatataagccacattacctctcgc
atcctggtaatgccctgcccctctgacggattcgagtcgacgtacaagacgaacaacatc
gaagacgtccgactatctctggagagccgatttgtcccacaaaaattaagcatttacaac
tttggccaacgaacagagccacggctaccgccacccgtgcgaacagttgaggcaggttcg
gtttatgggtgcccacaggcacatgctcctaatctgcagggcctttttaccgtatcagcc
gacatgtacaattttctaaatgcggaccccaaatctgtcgttatcgtgcagactggagac
tcgggtggatgcactgctgccaccgttatatgcgcgcttcttatgtatgcagatttgctg
cgggagccggaggacgcggtgcaagtcttcgccgttaagcggcataccattaacctccgc
ccctccgagttccgttacctgtattacttcggtgacatcctgcggcccacgcccctgctg
ccgcactataagaacacaacccttgtttcactcagctgccagcctgtgcccagaatgacc
aaggcacgcgacggctgtaggatctatatggaggtttattgtaatggaaacttgctactc
agcactctacaggactatgaaaaaatgcggttgtatcaggccggccccggcaaaatagtt
ctgccgattaacttgaccgcatgcggtgatgtgacagtggtattatttcacgcccgcaaa
ggaatggtgcgaccacaaggcctcaagatatgtcagttccaattcaacacgggattcatc
cccgaaccagaaacgttgattacattcacaaaccaggacttggatgatctgccagaccct
gagcaggtgacacctcggttctgcgtttcactttctctggctgttactgactcggaatca
cctcccagccataagccaccatggatgccagccaagcccaagcggtcacccgccgctttg
ttcagctcagatttggagtatgcagaaatgctcgacaattttggtgcccgcaagagtgat
cgcgtcagctctccgctcgttttgcccgacgtcacggagaccgcccacgaactgccttcg
cccatgccagagccatctccgcccatagacttgctcaatttaaaccagcagcccagtgac
gtaccagcagcagatccgttaaccagcgctaagcccagcacagatgccagctttgacttg
ctaggggccttcggtgatgatgactctacgggcataggatctgcgccaattcctgacata
ctgccaccaccgccactgcagcagccgcaaccaaaaataaacaatgacccattcgacata
tttggatctgtggaccaaggtggcgtgcccagcatgaagccatcaggctttccacctttc
gttggctccttaccaacttttgttgctcagccagcggctaccaccaatccttcaccaact
catccggcaagggcatctgcagatccatttgcgaacatcgccgacctggcgacagggctc
aacttaaactttaaccgcagcacgctaagtggaaagtctcccgtcaacactagtccgcag
cctactcagttctcaagccccactcacaagccatcgccatcctcgcaaccacaagcaacg
tttatgcatacaccgccgacaccgcagactctgccctcgacatcgtctatcaggacgccg
acgcagccacaggcggtacctgctcaatcaagaccagactacagtcgacttcactttgat
tctcagaaagcagcccagcaaccgggcactggcgggtccaagaactctgacatatttgct
gacattctgggccaacaaggatactcctttggcagcaaaatgaaccagtgtccacgatcc
atcaatgaaatgcgcaaggaagatttgttcaaggatatggacccgaagaaagtgcggatt
atggaatggactgatggtaagaaaaacaacatccgtgcgcttctctgctctatgcacaca
gtgttgtgggacaatgccaagtggcagcgctgcgagatgtccaccatggtgacaccgacc
gaggttaagaaagcataccgtcgcgcctgcctagcagtgcatcctgataagcataatgga
acagagaatgaagagattgccaagcttatatttatggaactaaacaacgcatggacagat
tttgaaaacgatgccacgcagcaaaatatgtttaatgcgtaa

DBGET integrated database retrieval system