KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11147Help
Entry
Dmel_CG11147      CDS       T00030                                 

Definition
CG11147 gene product from transcript CG11147-RA (EC:3.6.1.3)
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:25F4-25F4
AA seq 711 aa AA seqDB search
MAAVEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLN
GGEVVVLGAKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKF
KLLKELLQLPPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDF
LVETTRNSKLAVIITTHYIEEAKQANCIGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLI
LSQRQGNEDELAQIMDHNKNQALPAAVLPPEVIDTHEPNMPEKQPIPFEEPLNENRKKIF
FTTKGRVKALMTKNFVQLFRQPSGIIFMLLFPIIQLTCFYLAIGKTPTNLEIGVYSGEVE
NYGECFDENLVTVYKDSDNESCLFNKLSCRYIRVLGDDVATRKYYASEADALNDAKRATT
VGYLHFAQNFSDSILSVMEDGIHSSDGAVDHAELSIHIDMTDQQVAYFMQRKLRDKFSTF
MRSVVKDCNVSTAIVDLPVQFQEPIFGSTDIEFQQYCAPGVVMTMVFFLATLMTAAVFIS
ERMDGIWDRTLLAGVSATEMLWAHLLTQLIIMALQSFEVIMYIGLVFDTYNNGDTTTLIG
LLTLTAFCGMLFGLFISVFCKSHTEANFVATGAFYPMIILCGLLWPLESMPQFLQDLVMV
LPFTIPSISARNVIEKGWSITHEKVYNGFLVMAGWTIIFFVLCLIGIRRKA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgttgaggtacggaatggctataagtactatggctccaaatcaaatcccaag
attgtgcttaaccagctgaatatgaacgtgatgcgtggttctatatacggattgctgggt
gcctccggatgcggaaagacaaccctgctctcttgcatcgtcggccagaggcgcctcaac
ggcggcgaggtcgtcgtgcttggggccaagccaggagagcctggtagcggcgtgccagga
tcccgggtgggattcatgccccaggagattgccctggtcgaggagatgaccgtcaaggag
acaatcttctacttcggtcgcatctacggcctgacagacgaacgcatccgggagaagttc
aagctgctcaaggagctgctgcaactgccaccggctaggcagatgatcaagcagtgcagc
ggtggacagcagcgacgcttgtccttcgcctgcgccatgatccacgatccggagcttctc
attctggacgagcccactgtgggattggatccaatgctgcgtgaaaaaatctgggacttt
ctcgtggagacgacgaggaatagcaaattggctgtgattataaccacccattacatagag
gaagccaaacaggcaaattgtattggtcttatgcgcaatggtgttctattggctgaggat
actcctaccaacatcatgatcaagttcggaactcagtcgatcgaggacgccttcctcatt
ctgagccagcggcagggcaacgaagatgagttggcccaaatcatggatcacaataagaat
caggctttgccggcagctgtgctgccccctgaggtaatagacacacacgagcccaacatg
ccggaaaaacagcccatcccgttcgaggagcccctaaacgagaatcgcaaaaagattttc
ttcaccaccaagggcagggtaaaggcactgatgacaaagaactttgtacaactctttaga
caaccctcgggaattattttcatgctactatttcccatcatacaactgacgtgcttttat
ctggccattggcaagacgcccacgaatcttgaaataggagtttattccggcgaagtggag
aactatggggagtgctttgatgaaaacctggtcacagtctacaaggatagcgacaacgag
agctgtctattcaacaagttatcctgcagatacatacgcgtgttgggtgacgatgtggcc
acgcggaaatactatgccagcgaagcagatgctctgaacgatgcaaagcgggccacaacc
gttggctatttgcactttgcccagaacttcagcgattcgattctctcggtaatggaggat
ggcatccactccagtgacggagctgtggaccacgccgagcttagtatccacatcgatatg
acggatcaacaagttgcgtacttcatgcagcgcaaacttcgtgacaagttcagtacattc
atgcgcagtgttgtcaaggactgcaatgtatctacggccattgtagatctgcccgtccag
ttccaggaaccaatctttggcagcacggacatcgagttccagcagtactgtgccccagga
gtggtaatgaccatggtcttcttcctggccactttgatgacggctgcagtgttcatttct
gaacgcatggatggcatctgggatcgaactctattggcaggtgtctcggccaccgaaatg
ctgtgggctcatcttctaacccagctcatcatcatggccctgcagtcgttcgaggttatt
atgtatattggcctagtgttcgatacttacaataatggggataccacaacgctcattgga
ttgctaacactgaccgcattttgtggcatgttgttcggtctcttcatatccgtattttgc
aaatcgcatacagaggcaaactttgttgctactggtgctttttatcccatgatcatactg
tgtggactgctgtggcctttggagagcatgccgcagtttctgcaggatctagtgatggtg
ctacccttcaccattccctccatctccgctcgaaatgtgatcgagaagggttggagcatc
acccatgagaaggtctacaatggtttcctggtcatggccggctggacgatcatcttcttc
gtgctctgcctgatcggcatcagacgcaaggcgtaa

DBGET integrated database retrieval system