KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11159Help
Entry
Dmel_CG11159      CDS       T00030                                 

Definition
CG11159 gene product from transcript CG11159-RA (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:57A9-57A9
AA seq 146 aa AA seqDB search
MASHLPKGGALFLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAES
GRSTSKSMQLPNQSVSYGLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIF
NRHGFQAWPGWMSKCRGRTLPDVSRC
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcacttgcccaaaggtggtgcgctcttcctggtgctcaatcttctcctgctt
tcgcaatgggagaccgagtctaagctgctcacgcgttgtcagttggccaaggagctgttg
cgccatgactttccccgcagttatctatcaaattgggtttgcctggtggaagcggagagt
ggacgcagtacatccaaatctatgcagctgcccaatcagagcgtcagctacggtctgttt
cagattaacagcaaaaattggtgtcgcaaaggtcgtcgtggcggaatctgcaacatcaaa
tgcgaagagttccttaacgatgagatctcggatgactcgcgatgtgccatgcagattttc
aaccgccacggattccaggcctggcccggatggatgagcaaatgtcgtgggcgcacgctg
cccgatgtctcgcgttgctag

DBGET integrated database retrieval system