KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11198Help
Entry
Dmel_CG11198      CDS       T00030                                 

Gene name
ACC
Definition
Acetyl-CoA carboxylase (EC:6.3.4.14 6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dme01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dme00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dme00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:dme00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:44A1-44A2
AA seq 2323 aa AA seqDB search
MSETNESNDTAAQSAEGERPSFLVGDEIDERAAEAGEACDEFPLKMQNDVRQNGDISERR
KRLRPSMSRGTGLGQDRHQDRDFHIATTEEFVKRFGGTRVINKVLIANNGIAAVKCMRSI
RRWAYEMFKNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIA
LRTQVQAVWAGWGHASENPKLPELLHKEGLVFLGPPERAMWALGDKVASSIVAQTAEIPT
LPWSGSDLKAQYSGKKIKISSELFARGCVTNVEQGLAAVNKIGFPVMIKASEGGGGKGIR
RVDTTEEFPGLFRQVQAEVPGSPIFVMKLARGARHLEVQLLADQYGNAISLFGRDCSIQR
RHQKIIEEAPAIVAQPEVFEDMEKAAVRLAKMVGYVSAGTVEYLYDPEGRYFFLELNPRL
QVEHPCTEMVADVNLPAAQLQIGMGIPLYRLKDIRLLYGESPWGSSVIDFENPPNKPRPS
GHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAASGGLHEFADSQFGHCFS
WGENRQQARENLVIALKELSIRGDFRTTVEYLITLLETNRFLDNSIDTAWLDALIAERVQ
SEKPDILLGVMCGSLHIADRQITESFSSFQTSLEKGQIQAANTLTNVVDVELINDGIRYK
VQAAKSGANSYFLLMNSSFKEIEVHRLSDGGLLISLEGASYTTYMKEEVDRYRIVIGNQT
CVFEKENDPSLLRSPSAGKLINMIVEDGAHVSKGQAYAEIEVMKMVMTLTSQEAGTVTFV
RRPGAVLDAGSLLGHLELDDPSLVTKAQPFKGQFLQPENAPVPEKLNRVHNTYKSILENT
LAGYCLPEPFNAQRLRDIIEKFMQSLRDPSLPLLELQEVIASISGRIPISVEKKIRKLMT
LYERNITSVLAQFPSQQIASVIDSHAATLQKRADRDVFFLTTQSIVQLVQRYRNGIRGRM
KAAVHELLRQYYDVESQFQYGHYDKCVGLVREHNKDDMQTVVNTIFSHSQVAKKNLLVTL
LIDHLWANEPGLTDELANTLSELTSLNRAEHSRVALRSRQVLIAAHQPAYELRHNQMESI
FLSAVDMYGHDFHPENLQRLILSETSIFDILHDFFYHSNRAVCNAALEVYVRRAYTSYEL
TCLQHLELSGGLPLVHFQFLLPTAHPNRLFSRMSSPDGLDQAAAESLGNSFVRTGAIAAF
DSFEHFEMYSDEILDLLEDFVSPAMVNAKVLEAVEAADSISDSRHSTSINVSLSDPVTRA
NAAEEAKSTEPIHIVSVAVRETGELDDLQMAQIFGNYCQEHNEELFQRRIRRITFAALKK
RQFPKFFTFRARDKFTEDRIYRHLEPASAFHLELNRMKTYDLEALPTANQKMHLYLGKAK
VSKGQEVTDYRFFIRSIIRHSDLITKEASFEYLQNEGERVLLEAMDELEVAFSHPHAKRT
DCNHIFLNFVPTVIMDPAKIEESVTKMIMRYGPRLWKLRVLQAELKMVIRQSPQSPTQAV
RLCIANDSGYFLDISMYTEQTEPETGIIKFKAYGEKQGSLHGHPISTPYMTKDFLQQKRF
QAQSNGTTYVYDVPDMFRQMTERHWREFSKARPTVDIRTPDKILIECKELVLEGDNLVEM
QRLPGENNCGMVAWRIVLATPEYPNGREIIVIANDLTYLIGSFGIKEDVLFAKASQLARQ
LKVPRIYISVNSGARIGLAEEVKAMFKIAWEDPEEPDKGFKYLYLSTEDYAQVANLNSVR
AILIEDEGEQRYKITDIIGKDDGLGVENLRYAGLIAGETSQAYEEIVTIAMVTCRTIGIG
SYVVRLGQRVIQIDNSHIILTGYAALNKLLGRKVYASNNQLGGTQIMFNNGVTHKTEAID
LDGVYTILDWLSYIPAYIGCDLPIVLPNDRIERPVDFMPTKSPYDPRWMLGGRVNPVNAN
DWENGFFDRDSWSEIMASWAKTVVTGRARLGGVPVGVIAVETRTVEVEMPADPANLDSEA
KTLQQAGQVWYPDSSYKTAQAIKDFGREELPLIVFANWRGFSGGMKDMYEQIVKFGAYIV
DGLREYKKPVLIYLPPNAELRGGAWAVLDSLINPRYMETYADPEARGGVLEPEGIVEIKY
KEKDLVKTIHRLDPTTIALKKELDEANASGDKVRAAQVDEKIKARIAVLMHVYHTVAVHF
ADLHDTPERMLEKECISEIVPWRDSRRWLYWRLRRLLLEDAYIKKILRAQDNLSVGQAKQ
MLRRWLVEEKGATEAYLWDKNEEMVSWYEEQINAESIVSRNVNSVRRDAIISTISKMLED
CPDVALDAVVGLCQGLTPVNRGVVVRTLAQMQLNEETSNSNQG
NT seq 6972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacaaatgagtccaatgacacggccgcccaatccgccgagggcgagcggccc
agctttttggtgggtgatgagatcgacgagcgggccgccgaggcgggcgaggcatgtgac
gagttccccctgaagatgcagaacgatgtccgccagaatggcgatatttccgagcggcgc
aagcggttaaggccgagtatgtcgcgtggcacagggctgggccaggaccggcaccaggat
cgcgacttccacatcgcaaccaccgaggagttcgtgaagcgctttggcggcacccgagtg
atcaacaaggtcctgattgccaacaacggtatcgcggccgtcaagtgcatgcgatccatc
cggagatgggcgtacgaaatgtttaagaacgagcgggccattaggtttgtggtgatggtc
actccggaggatctaaaggcgaatgccgaatacatcaagatggcggatcactatgtgccc
gtgcccggcggatcgaacaacaacaactacgccaatgtcgagctcatcgtggacattgct
cttcgcacccaagtgcaggccgtgtgggctggttggggtcatgcctccgagaacccgaag
ctgccggagctgcttcacaaagagggtctggtgttccttggccctccggaacgtgccatg
tgggcgctgggcgacaaggtggcctcctctattgtggcccaaacggccgagattcccacc
ctgccgtggtccggttcggacctgaaggcccagtacagtggcaaaaagatcaagatttcc
agtgagctcttcgcccgaggttgtgtgaccaatgtggaacagggtctggccgcagttaac
aagattggcttccccgtaatgatcaaggcctcggaaggaggtggtggcaagggtattcgc
cgcgtggacaccactgaggagttccccggcctgttccgccaggttcaagctgaggtgccc
ggctcaccgattttcgtgatgaagctggcccgcggagctcgccacttggaggtgcaactg
ttggcagatcagtacggcaatgccattagcttgttcggccgtgactgctccatccagcgt
cgtcatcagaaaattattgaggaagctcctgccatcgtggcccagccagaggtgttcgag
gacatggagaaggccgccgtgcggttggccaagatggtgggttacgtcagcgcgggaacc
gtggagtacctatatgatccggagggtcgctacttcttcctggagctgaacccacgtttg
caggtggagcatccgtgtacggagatggtggccgatgtaaatcttccagctgctcagctg
cagattggaatgggaattcccctttaccggctcaaggacatccgtctgctgtacggagag
tctccctggggctcctcagtcattgacttcgaaaatccaccgaacaaaccgcgtccctcc
ggacatgttatcgctgctcgtatcacctcagagaaccccgacgagggctttaagcccagt
tctggaaccgttcaggagcttaacttccggtcgagcaaaaatgtgtggggctacttcagt
gtggctgccagtggaggattgcacgagttcgcggattcacagtttgggcattgtttctcc
tggggcgagaaccgtcaacaggctcgagagaacctggtgattgccctgaaggagctgtca
attcgaggtgatttccgaaccacagtggaatacttgatcactctgctcgaaacgaatcgg
ttcctcgacaacagcatcgacaccgcctggctagatgccttgatcgcagagcgtgtgcaa
tccgagaagccggatatcctgttgggcgtaatgtgcggatcgctgcacatcgcagatcgt
caaattactgagagcttttccagcttccaaacctctctggagaaaggtcagatccaagca
gcgaacacgctgacgaacgtggtggatgttgagctaatcaacgatggcatccgttacaag
gtgcaggccgccaagagcggagccaactcgtacttcctgctgatgaacagctcgtttaag
gagatcgaggtgcaccgcctctccgacggaggcttgctcatctctttggagggcgcctcc
tacaccacgtacatgaaggaggaggtggatcgctaccgcattgtgattggcaaccagaca
tgtgtctttgaaaaggagaacgatccatcgctgttgcgcagtccgtctgcgggaaagctc
atcaacatgattgtggaagatggcgctcatgtaagcaagggccaggcctatgctgagatt
gaggtgatgaagatggtgatgaccctgacgtcccaggaggcaggcacagtgacatttgtg
cgtcgaccaggagctgttctagatgcaggatcccttttgggccacttggagctggacgat
ccatcgctggtgacgaaagcgcagcccttcaagggacagttcctgcagccagagaacgca
ccggtacccgagaaactaaacagggtgcacaatacttacaagagtatccttgaaaacaca
ctggctggttactgcctgccagaaccgttcaatgcacagcgactcagagacatcatcgaa
aaattcatgcaaagcttgcgtgatccctcgttgccgttgttggagctgcaagaagttatc
gcctccatctctggtcgcatacccatatccgtggagaagaagatccggaaactgatgacg
ctgtacgagcgaaacataactagtgtcctggcccaattcccctcgcagcagatcgccagt
gttattgacagccatgcggccacgctgcagaagcgcgctgaccgtgatgtcttcttcctg
accacccagagcattgtgcagctggtgcagcgctataggaacggaatccgcggcagaatg
aaggccgccgttcatgagctgttgcgtcagtactacgatgtagagtcgcagttccagtat
ggacactacgacaaatgcgtgggactggtgcgagagcacaacaaggacgacatgcagacg
gtggtcaacaccatcttctcgcactctcaggtggccaagaagaatctgctggtcactctg
ctcattgatcacctgtgggccaacgaacctggactaacggacgaattggccaacacgcta
agtgaattgacctctttgaatcgagctgagcactctagggttgccctgcggtcccgccaa
gttctgatcgctgcccaccagccggcttatgagctgcgccacaaccaaatggagtcgatc
tttctctccgccgttgacatgtacggtcatgacttccaccccgagaacctgcagcgcctg
attctgtcggagacctcaatctttgacatcctgcacgacttcttctaccactctaaccgg
gcagtgtgcaatgctgctctggaagtctatgtgaggagagcttacacatcctatgagctg
acctgcttgcagcatttggaactctccggtggcctgccgctggtgcacttccagttcctc
ctccccacagctcacccgaacagactgttctcgcgcatgtcctcccccgatggattggat
caggcagcggcagagtctttgggaaactcattcgtgcgcaccggagcgattgcagccttt
gactccttcgaacactttgagatgtactcggacgagattctggatctgctcgaagacttc
gtctcgccagccatggttaatgccaaggtcctggaagccgtagaggcagcggattctatc
tcggacagccgacacagcacctcgatcaatgtgtcgttgtcggatcccgtaacccgggcg
aatgctgccgaggaggccaagtccaccgaaccgattcacattgttagtgtggctgtgaga
gaaacgggggagttggatgacctgcaaatggcccaaatctttggaaattattgccaagag
cataacgaggagctcttccagcgacgcattcgtaggattacatttgctgctctgaagaag
cggcaattccccaagttctttacgttcagagccagagataagttcacggaggatcgtatt
taccggcatctggagccagcatctgctttccatctggagctgaaccgcatgaagacgtac
gatctggaggctctgcccacggctaaccaaaagatgcacctgtaccttggcaaggccaag
gtttcgaaaggtcaagaggtcacggactaccgcttcttcattcgctcgatcatccgtcat
tcggatctgattaccaaggaagcctctttcgagtatctgcaaaacgaaggagagcgtgtg
ctcctggaggccatggatgagctggaggtggcattctcgcatccgcacgccaaacgcacg
gactgcaaccacatcttcctgaactttgtgcccaccgtcatcatggatccggctaagatc
gaggaatctgtaacaaagatgattatgcgatatggtccacgtctttggaagctgcgtgta
ctgcaggctgagctcaagatggtcatccgccagtcaccacagtcacccactcaggcagtg
cgtctgtgcattgcaaatgactccggctacttcctggatatttcgatgtataccgaacaa
acagaaccagagacaggaatcattaagtttaaggcctacggtgagaagcagggatctctg
cacggacatcccatttcgacgccctacatgaccaaggacttcctgcagcagaaacgtttc
caggcgcagtccaatggtaccacctatgtctatgatgtgcccgacatgttccgccagatg
accgagcgtcactggagagaattctccaaggctcgtcccaccgtggacattcgcactccc
gacaagattttgatcgagtgcaaggagctggtcctcgagggcgacaaccttgtagagatg
cagcgtctgcccggcgaaaacaattgcggcatggtggcttggcgcattgtcttggctact
ccggaatatccgaatggccgcgagatcattgttatagccaacgatctcacctacttgatt
ggttcctttggaattaaggaggacgttctctttgccaaggcttcccaattggctcgccaa
ctcaaagtaccgaggatatacatctccgttaacagcggtgcccgcataggacttgctgag
gaggttaaagctatgttcaagatcgcatgggaggatccagaggagccagataagggcttc
aagtacctctacttgagcaccgaggactacgcccaggtggccaacctgaactcggtgagg
gctatcctgatcgaggacgagggcgagcagcgttacaagattaccgacatcatcggcaag
gacgatggtctgggcgtggagaatctgcgttacgccggcttgattgccggtgaaacgtcg
caggcctacgaggagattgttactatcgctatggttacctgccgtaccattggcattgga
tcctatgtggtgcgcctgggtcagcgcgttatccagatcgataattcacacattatactc
actggctatgctgcgcttaacaagctgcttggacgcaaggtgtatgcctctaataatcag
ttgggtggcacacagatcatgtttaacaacggagtcacccacaaaacagaggccatcgac
ttggacggtgtctacaccatcctcgactggctctcgtacatccccgcgtacatcggttgt
gacctgcccattgttttgcccaacgatcgtatcgaacgccctgtcgacttcatgcccacc
aagtcgccctacgatccgcgctggatgctgggtggccgtgtgaatcccgtgaacgctaat
gactgggagaacggattctttgatcgcgactcgtggagcgaaatcatggcctcgtgggcc
aagacagtggtcactggtcgcgcacgtctaggcggtgtccccgtgggcgtaatagccgtt
gagacccgcaccgtagaagtggagatgcccgccgatcctgccaatctcgattcggaagcc
aagaccctgcagcaggcaggtcaggtgtggtaccccgactcctcgtacaaaacggcacaa
gcgatcaaagattttggacgagaggagttgccgctgattgttttcgcaaattggcgaggc
ttctccggtggcatgaaggacatgtacgagcaaatcgtcaagttcggagcatacattgtc
gacggcctgcgggagtacaagaagcctgtgctcatctacctgccgcccaacgccgagctg
cgaggtggagcctgggccgtgttggattccctcattaacccgcgctacatggaaacgtat
gccgatccggaggccagaggaggagttctcgagccggagggcattgtggaaataaagtac
aaagagaaggacctggtcaagacgattcaccgcttggatccgaccaccattgcgctgaaa
aaggagctcgatgaggcaaatgcgtctggcgacaaggtcagggctgctcaggtggacgaa
aagatcaaggcccgcatcgctgtgctaatgcacgtctaccacacggtagcagttcacttt
gccgacctgcacgacacgccggagcgaatgctagagaaggagtgtatcagtgagattgtg
ccttggcgcgattcccgccgctggctgtactggcgtctgcgacgtctcctgttggaggac
gcatatattaagaagatcctgcgcgctcaggacaacctctccgtgggtcaggccaagcag
atgctgcgtcgatggctggtagaggagaagggtgccacagaggcttatctgtgggacaaa
aacgaggagatggtgtcttggtatgaggagcagatcaatgccgaatctattgtttcccgc
aacgtgaactccgtgagacgggatgccattatttctaccatttcgaaaatgctcgaggac
tgtcccgacgtagcgctggacgctgttgtgggtctttgccaaggtctgacgccagtgaat
cgaggcgtggtcgtacgcacattagcccagatgcagctgaatgaggagacctctaacagc
aaccagggatga

DBGET integrated database retrieval system