KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11236Help
Entry
Dmel_CG11236      CDS       T00030                                 

Definition
CG11236 gene product from transcript CG11236-RA (EC:1.4.3.1 1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dmel_CG11236
   00330 Arginine and proline metabolism
    Dmel_CG11236
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dmel_CG11236
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dmel_CG11236
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dmel_CG11236
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dmel_CG11236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:27B3-27B3
AA seq 338 aa AA seqDB search
MPNIAVIGAGVNGVASAIKILEHYVNDGKTPIKVTIISEDFTPNTTGDGSAGLWGPYLLG
GTSQAKVYKWSKSMHQFLEKIWLSEDAGEAGVCLLPCIRLSTSTVDTVEDFWRDIVYGAV
DLSKEQLAAYNKGRSVKFTSGLSFVTYTSEPIKLLPYLMKRFTRNGGVVVRKRITDLDAF
VADSEYDVIVNCSGLGSKTLLNDDQMYAVRGQVSRVRANWIFSAVLDESDDGNYIIPNVV
LGGTHQERDYNTKVCQNDRRMIVDGCQRYIPGLEHTECLFDWVGLRPGRTQLRLEAERRG
RKLLIHNYGHGGSGVTLCWGCADDVLNILLAAKNGSKL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacattgcagttatcggtgccggggttaatggtgttgccagtgccattaagata
ctggaacactatgtgaacgatggaaagacacccataaaggtgacgatcatatcggaggac
ttcacgcctaacacaactggagatggttcggctggtctctggggtccgtaccttctgggc
ggcacttcgcaggcgaaagtctacaagtggtcgaagagcatgcaccaatttttggagaag
atctggctgagcgaggatgccggagaggctggcgtttgtctgctaccctgcattcggctg
agcacctcaacggtggacacggtcgaagatttttggcgtgacattgtctatggagcagtg
gatctgtccaaggaacagctggctgcctacaataaaggtcgcagcgttaagttcacgtct
ggtttatcctttgttacctacacctcggagcccattaagctactgccgtatttgatgaag
cgtttcacccgaaatggaggtgttgttgtccggaaaaggattacagacctggatgcattt
gtagccgattccgagtacgatgtgatagtcaattgctccggattgggctctaagacccta
ctaaacgacgatcaaatgtacgcagtgcgtggccaagtttcccgggtgagggccaactgg
attttctctgccgtgctggacgagagtgatgatggcaactatattatacccaatgttgtc
ctgggcggaacccatcaggagcgggactacaacactaaagtctgccagaacgacaggcgg
atgatcgtcgatggctgtcagcggtacattcctggtttggagcacacggagtgcctcttt
gattgggtaggtctccggccgggtcgcacccaactccgactggaagccgagcgccgcggc
cgcaagctcctcatccacaactatggacatggcggcagtggagtcactttgtgctggggc
tgtgccgacgatgtcctcaatatcctgttggccgccaagaacggttccaaattataa

DBGET integrated database retrieval system