KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11289Help
Entry
Dmel_CG11289      CDS       T00030                                 

Gene name
CG11289
Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG11289 (CG11289)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG11289 (CG11289)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG11289 (CG11289)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG11289 (CG11289)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG11289 (CG11289)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG11289 (CG11289)
   00983 Drug metabolism - other enzymes
    Dmel_CG11289 (CG11289)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG11289 (CG11289)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG11289 (CG11289)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 33993
NCBI-ProteinID: NP_609097
FlyBase: FBgn0031887
UniProt: Q9VM44
Position
2L
AA seq 502 aa AA seqDB search
MKRSPISWSLLWMGYTCIFLLADSPAPVESHHILGLFVNVHRSQLMVHLAVCRALLQRGH
HLTLVTTLPLEEQEIQGNVSHIYIPWQQPKEEVSSSDLILRLERMFRRLEHSGDLLDLPE
WKMFLRNQPNTPYDLLLLGYHFNDHLLGVAAHFNCPVAIVSTQQPTGFVNSLMGNPEERW
YVPQPYDGQQRSGISAWVFGMWEKFMEILARRVLARIYRLHFPEPQYPSFETMRRSVVLA
LSNHHMISEGPIAPLIPSMVDIGGIVLEQQLDKTPLEISAGNRSLIIFSLGTRFTWRKST
KELVRTFTKAFAQFPDYDIYWTYDGPNGSAISLDYPHLKVAKWWPQTQMWQSGKVRLFIT
HGGKGSVSEALFYGVPMLGLPLIGDQRDNLQRMQSKNWGLTLSTNNLTHWKLAKAITRML
SDSSYGETILKASQLYRDRPVSPSDLVTYWIEYIVRHKGAKNLHNPARQLNIIEYHSIDV
YFIVYGLLILTIAILRKVNSLL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttcgccgatcagttggtcacttctgtggatgggctacacatgcattttcctg
ctggccgatagcccagcccctgtggaatcccatcacattttgggtctctttgtcaatgtg
caccggtcgcagttaatggtccatttggcggtatgtcgcgctcttttgcagaggggtcac
cacttaaccctagtcaccacattgccgctggaggagcaggaaattcagggaaatgtgtca
cacatttacattccctggcagcagccaaaagaggaagtatcctcctcggacctcattctg
cgcctggaacggatgtttaggcgtttggagcattctggagatctgcttgatctgccggag
tggaagatgtttctcagaaatcaacctaatactccctatgatctcctcctcttgggctat
catttcaacgatcatctgctgggagttgctgcgcatttcaattgtccagtggccatagtt
tccacccaacagccaactggatttgtcaacagccttatgggtaatcccgaggagcgttgg
tatgtcccacagccgtatgatggccaacagcgaagtggaatctcggcctgggtctttgga
atgtgggagaagttcatggagattttggcgaggagagtgctggcaaggatctaccgtttg
cactttcccgaaccgcaatatcccagttttgaaaccatgcgacggtcggtggttctggct
ttaagtaatcatcacatgatcagcgagggtcccatagctccacttattcccagtatggtg
gatataggaggtatagtcctagagcaacagcttgataagactcctctggaaatatcagcc
ggcaatcgatctctcatcatcttcagtttgggcactcgtttcacttggcggaagtccact
aaagaactggtgcggactttcacaaaagcttttgctcagtttccggactatgacatttac
tggacctacgatggtccaaatggtagtgccatcagcttggattaccctcaccttaaagtc
gccaagtggtggccccaaacgcagatgtggcaaagtggcaaggttcgattgttcatcact
catggaggcaaaggcagtgtctcagaagctcttttttacggagtgcccatgctgggacta
cccttaattggcgatcaacgagataatcttcagagaatgcagtcgaaaaactggggtttg
accttatccaccaacaatctgacgcattggaaactagcgaaggccataactagaatgctt
agcgattcgagttatggtgaaactatattgaaagcttctcaattgtatcgcgatcgtcca
gtgagtcccagcgatttggtgacctattggatcgagtatatcgttcggcataaaggagct
aaaaatttgcacaatcccgccaggcaactcaatataatcgaatatcattccatcgatgtt
tattttatagtttatgggctcttaatcctaacgattgccatactcagaaaagtgaatagc
ttgctgtga

DBGET integrated database retrieval system