KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11289Help
Entry
Dmel_CG11289      CDS       T00030                                 

Definition
CG11289 gene product from transcript CG11289-RB (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG11289
   00053 Ascorbate and aldarate metabolism
    Dmel_CG11289
   00500 Starch and sucrose metabolism
    Dmel_CG11289
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG11289
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG11289
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG11289
   00982 Drug metabolism - cytochrome P450
    Dmel_CG11289
   00983 Drug metabolism - other enzymes
    Dmel_CG11289
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG11289
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG11289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:27D7-27E1
AA seq 502 aa AA seqDB search
MKRSPISWSLLWMGYTCIFLLADSPAPVESHHILGLFVNVHRSQLMVHLAVCRALLQRGH
HLTLVTTLPLEEQEIQGNVSHIYIPWQQPKEEVSSSDLILRLERMFRRLEHSGDLLDLPE
WKMFLRNQPNTPYDLLLLGYHFNDHLLGVAAHFNCPVAIVSTQQPTGFVNSLMGNPEERW
YVPQPYDGQQRSGISAWVFGMWEKFMEILARRVLARIYRLHFPEPQYPSFETMRRSVVLA
LSNHHMISEGPIAPLIPSMVDIGGIVLEQQLDKTPLEISAGNRSLIIFSLGTRFTWRKST
KELVRTFTKAFAQFPDYDIYWTYDGPNGSAISLDYPHLKVAKWWPQTQMWQSGKVRLFIT
HGGKGSVSEALFYGVPMLGLPLIGDQRDNLQRMQSKNWGLTLSTNNLTHWKLAKAITRML
SDSSYGETILKASQLYRDRPVSPSDLVTYWIEYIVRHKGAKNLHNPARQLNIIEYHSIDV
YFIVYGLLILTIAILRKVNSLL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttcgccgatcagttggtcacttctgtggatgggctacacatgcattttcctg
ctggccgatagcccagcccctgtggaatcccatcacattttgggtctctttgtcaatgtg
caccggtcgcagttaatggtccatttggcggtatgtcgcgctcttttgcagaggggtcac
cacttaaccctagtcaccacattgccgctggaggagcaggaaattcagggaaatgtgtca
cacatttacattccctggcagcagccaaaagaggaagtatcctcctcggacctcattctg
cgcctggaacggatgtttaggcgtttggagcattctggagatctgcttgatctgccggag
tggaagatgtttctcagaaatcaacctaatactccctatgatctcctcctcttgggctat
catttcaacgatcatctgctgggagttgctgcgcatttcaattgtccagtggccatagtt
tccacccaacagccaactggatttgtcaacagccttatgggtaatcccgaggagcgttgg
tatgtcccacagccgtatgatggccaacagcgaagtggaatctcggcctgggtctttgga
atgtgggagaagttcatggagattttggcgaggagagtgctggcaaggatctaccgtttg
cactttcccgaaccgcaatatcccagttttgaaaccatgcgacggtcggtggttctggct
ttaagtaatcatcacatgatcagcgagggtcccatagctccacttattcccagtatggtg
gatataggaggtatagtcctagagcaacagcttgataagactcctctggaaatatcagcc
ggcaatcgatctctcatcatcttcagtttgggcactcgtttcacttggcggaagtccact
aaagaactggtgcggactttcacaaaagcttttgctcagtttccggactatgacatttac
tggacctacgatggtccaaatggtagtgccatcagcttggattaccctcaccttaaagtc
gccaagtggtggccccaaacgcagatgtggcaaagtggcaaggttcgattgttcatcact
catggaggcaaaggcagtgtctcagaagctcttttttacggagtgcccatgctgggacta
cccttaattggcgatcaacgagataatcttcagagaatgcagtcgaaaaactggggtttg
accttatccaccaacaatctgacgcattggaaactagcgaaggccataactagaatgctt
agcgattcgagttatggtgaaactatattgaaagcttctcaattgtatcgcgatcgtcca
gtgagtcccagcgatttggtgacctattggatcgagtatatcgttcggcataaaggagct
aaaaatttgcacaatcccgccaggcaactcaatataatcgaatatcattccatcgatgtt
tattttatagtttatgggctcttaatcctaacgattgccatactcagaaaagtgaatagc
ttgctgtga

DBGET integrated database retrieval system