KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11290Help
Entry
Dmel_CG11290      CDS       T00030                                 

Gene name
enok
Definition
enoki mushroom (EC:2.3.1.48)
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG11290 (enok)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:60B10-60B10
AA seq 2291 aa AA seqDB search
MMRESAHDINMDTWNQWILEAISKIRSQKQRPSVQRICQAIGTHHKFHEDIVAEKLEKAV
ESGAVIKVYNKGLHSYKAPMAKRRVKVDKNTNLYKLVAKAVHDLGECEGSTIKSIENYIQ
KFNCIDLSPNVDFKAVIKASIKKAVDAGFLIQEGKLYKKGKSLTTPRKCAPVSEVVIKGE
ESCTHCSGNSQKNLNGIPEPLSSCKQCGISLHTTCANIAGRCKSQSYVLLYMLVTKGTIW
DCQNCADCAVCKMRNRGPCLLQCFVCKDHFHLTCLDTIPDKKPKHPYRCKTCSKQGFDTP
KLVKKDNSRIKMEAERMTPSYKYASNKRQSIKKDGNIESPSTSKLCVYNDGNGQRRKVPA
SLSSRKMNHSEDQFEFPSKQKRSQILQGGYLASQETRKRTFSDLSSTSSSSESEDEDDED
DDRNRNGDDNDQDESTSSDSCTSSSSDSDSSESSSDTSEWDDEYDEEEDYDTDRSTIREK
NVFESGKQSCAKLSTGDGLGSPQNNELGSENWGFAAVAKNPIDIFVKSKHNSNVKGIGYS
KPAASTFATSPAANRVQKSTPVASSTPEKNSAPIGGMTIKRQTANGQKKKIVPLKSMPLE
AGKSYEKCEDDIPYLTEETVMKVQLLEEIERSRETHSQADGKREMNNDEDAPGESTKRAN
PFENQPLPPGVTATDVELYQEVLHKAVVQMSNNHIEKVNDVSLKSGQNTQSPKSIQIGKW
DIETWYSSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGNIS
VFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKH
CTQKYNVSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKS
VVLEYLYKHRNYTKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEW
KKVLAHHNKMANSKTRIIIEPDCLRWSPLLSVSKLPNIIKPISNREYLSNQMETNSSFKE
INEDKISVKQGVSTSSKVNQESSELSTKNRGPSSEKLIDERENQRKRAYPEEFLKSASNE
AKKPKLTAPQPNLEDQSFGELSDSSDCKSSKDLSEQLTKRAQRLAKRNDLIPHTNKRKHF
DRPLENNTTSTDHNPPAQSQADTAGTENGHKSEETAAKENCKNVVEKEHVDKPVNIMPKL
RGKQSNGKRSEEPQFNENPTSDPVAVASLSPAKEITREPVKVAKTESPGKNQESAKHDAE
PNSVSDQVLDAVAKKTKKTLFSDVASYNTEDVKYNSEEKPMAIAQEPKESPTEAGIKETK
PLEVPEQKAKAKSPEKPATVAETVLQHVHAPVNTEKISTEESKLELDVHYLKLSPDSALN
PPVASVQKPVPEPPAPKEKAKDLQAAQPSEALQKQPEIEMVKKTETKTETPVSNPPSNRT
DVSSLVEQPVKAAPEKVEQPMVKEAVDIKDKALKKPVPDVPVVKPEATSCEKKIDHSKTK
VFHEKEAIKTDQQLVQVKEEEKSNARAPSAPIPIRDKIQLKGNEHAQLQNSIPSQFPLNQ
MPNYHTSQYWQWEYYGYNLSHLDASQKGQKQFHKDLATTMAYTHNFTQNLYQSANLAMQH
AHHQMHQTKEKHKVERKNSGKKEEQNKVVSSVNVVSTAREDAHVQHCNEYAANNQAALYN
QKCASQQKQAQQMKSLANVQNPVPRQSNSNAPESTVLMPNPVISQAGSVPAKQKVEHGVN
STSVISREGKLNKIGHSNIHATAQHANLQVGGGQSDVNPNMVYNTESSANSAMQHYDCGI
SAQINMDSPANIGSAIAHGPQEISATSNVHMHQPHRQFSDCSMQNQPVTTPMHMSIQNSH
MQQQNNLNLNLAPEGSSNINLLSNPQHQHQSRKLNAQADIAVSSPTPSHRATTPKQIRSG
NTQQRDAKNAAPPTTTTNTHHQIPQGGAAANISKSHHDSLHNLQFSQHGHQQNMQPIDYV
PIPQISQNFSANPSNYDIVGMPAVIQQRMSLNGSVHSLANSHQRIEQPSSACAVNNFYLQ
NNMPAAENAPRVPVSSSLGGPPTAGNNDQRQAGQDSITTANSSGATASLAGNLCSLSKLQ
QLTNCLESQPCNTSPGAQVNLAPSPHHPIPPNSTPPPHLLMQNRNISTPPNMLQTQVTPL
QYKYYPGNMNIPPITSAQNTSRNTRNTPSAPVQHTSTPMGSGNNRTANVHISPNLMAPYG
AINSYRMSPQQSPPTGSYSSGGDYPNSQIPMQMMNMQSQYQDACVLQRGTPSNPMYPTYS
PYLPLNGSIRR
NT seq 6876 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggaatcggcgcatgatatcaacatggacacctggaatcagtggatcctcgag
gccatatcaaagatcaggtcccagaagcagaggccctccgtgcagaggatttgccaggcg
atcggcacacaccacaagttccacgaggacattgtggcagagaagctggaaaaagctgtc
gagtcgggagccgtcataaaggtctacaacaagggactgcactcctacaaggcaccaatg
gccaagcgtcgcgtcaaggtggacaagaacactaatctgtacaaattggtggccaaggcg
gtccacgacctgggcgaatgcgagggatctaccatcaagagcattgagaactacattcag
aagttcaactgtatcgacttgtcgcccaatgtggacttcaaggcggtcattaaggcttcg
atcaagaaggccgtggatgccggctttctgatccaggaggggaagctatataaaaagggc
aaatccttgacaaccccacggaaatgcgcacccgtctcggaggtggtcataaagggcgag
gagtcctgcacccactgctcgggaaattcgcagaagaacctcaacggaatcccagagccc
ttgagctcctgcaagcagtgtgggatctcattgcacaccacctgcgccaacatcgccggc
aggtgcaagtcgcaatcctacgtgctgctctacatgctcgtcaccaagggcactatctgg
gattgccagaactgcgcggactgcgccgtttgcaaaatgagaaatcggggcccgtgctta
ctgcagtgcttcgtgtgtaaggaccactttcacttaacgtgtcttgatacgattccagac
aaaaagccgaagcatccatacaggtgtaagacatgctccaagcaaggctttgatactccg
aagttggttaagaaagacaattcaagaattaaaatggaagctgagagaatgaccccctcg
tataaatatgcctccaataagcgccaatccatcaaaaaggatggcaacatcgagagtcct
tcgacctcgaaactttgtgtctacaacgacggcaacggccagagaaggaaagtgcccgcc
agcttaagctctagaaaaatgaaccacagtgaggaccagttcgagttccccagcaagcaa
aagaggtcgcaaatattacagggaggctacttggctagccaggaaacgcggaagcgaacc
ttttcggatctgtcctccacgagttcgtccagcgagagtgaagacgaagacgatgaggac
gacgacaggaacaggaatggcgatgacaacgaccaagacgagagcacgtcgtcggattcg
tgcacatcatccagctcagattctgactccagcgagagttccagcgacacctccgaatgg
gatgacgaatacgacgaggaagaagactacgacacagatcgcagcacgataagggagaaa
aatgtctttgagagtggcaagcagagctgcgctaaacttagtactggcgatggcctaggc
tccccgcaaaacaatgaattgggtagcgagaattgggggtttgctgccgtggcaaaaaac
cccatcgatatatttgtgaaatcgaaacataatagcaatgtcaaaggaattggttactcc
aagccagcagcaagcacgtttgccacgtcccccgcagccaatcgagtgcaaaagagcact
ccagtagcttcgtctactcccgaaaaaaactctgcaccgattggcggcatgacaattaag
cgtcagactgccaatgggcagaagaaaaagattgttcccttgaagagcatgcccctcgaa
gcgggcaagtcgtacgaaaaatgcgaggacgacattccgtatctaacagaggagactgtt
atgaaagttcaactgctagaggagatagaacgcagcagagagacccacagccaagctgat
ggaaagcgggaaatgaacaacgacgaggatgcgcctggggaaagtacaaagcgggccaat
ccctttgagaaccagccccttccgcctggtgtcaccgccacggatgtggaattgtatcaa
gaggtgctccataaggccgtcgttcaaatgtccaataatcatatagagaaggtgaacgac
gtaagcctgaaatccggacagaacacccagagtccaaagtcgattcaaattggaaagtgg
gacattgaaacctggtactccagcccctttccgcaggagtacgccaggttgctgaaactg
tttttgtgcgagttctgcctcaagtacacaaagagtcgttctgtgctggacaggcatcag
aacaaatgcatttggaagcagccgccaggcactgaaatattcaggcagggaaacatatcg
gtgttcgaggtggatggcaatgtcaacaagatttattgccagaacctgtgcctgctggcc
aagttctttctcgaccacaaaacactctactacgacgtagaaccctttctgttctatatt
ctcactaagaatgatcaaagcgggtgccatttggttggctacttctcaaaggagaagcac
tgcacccaaaagtacaatgtgtcctgcatcctgacgatgccgcagtaccagaggcaaggc
tacggtcgcttcctgatcgacttcagctacctattgagccgagaggagggacagctgggc
actccggagaagcctctctccgatctgggacgactttcctacttttcctactggaaatca
gtcgtgttggagtatttgtacaagcatcgcaactacacaaagatcaccttcaaggacatc
gccattaaaacaggtctggctatttccgacatcgccctggccttcgagttattgaacttc
atcaagctaagaaagaacgatggcgacattaggtatcagattaatgtgaaaattgagtgg
aaaaaggttttggcccaccataacaaaatggcgaacagcaagacgcgaataatcattgaa
cccgactgcttgaggtggagtccgttgctgtcggtgtcgaaattacccaacataatcaag
cccatttctaatcgtgaatatttgagcaaccaaatggagacaaattctagtttcaaggaa
attaatgaagacaaaatcagcgtaaagcagggtgtttccacgtcctcaaaggtgaatcag
gagtcttccgagttgtctaccaagaatcggggacccagctcggaaaagttaattgacgaa
agggaaaaccagcgaaaacgtgcatatccggaggagttcttaaagtcagcgtctaatgag
gcaaagaaacccaagttgactgcacctcagccgaacctcgaggatcagtctttcggtgag
ctctccgactcatcggattgcaaatcttctaaagatctttcggaacagttgaccaaaaga
gctcaaaggttggccaaacgcaacgacctcatcccccacaccaacaaaaggaagcatttc
gaccggccccttgagaacaatactacttcaaccgaccataatccgccagctcaaagtcaa
gcggatactgcgggcaccgaaaatggccacaagtcggaagaaacggctgccaaggagaac
tgcaaaaatgttgtggaaaaggagcatgtcgacaagccagtcaacattatgcccaaactg
cggggtaagcagtccaatggtaagcgttccgaggagcctcagttcaatgaaaatcctaca
tcagacccagtcgcagttgcctcgctgagtccagccaaggaaataactagggagccggtt
aaagtggcaaaaacggagagtcctggcaaaaaccaggagtcggccaagcacgatgctgaa
cccaatagcgtcagcgatcaagtgcttgatgcagtggccaagaagacgaaaaagacgttg
ttctctgatgtagcatcgtacaacactgaggatgtaaaatataattcagaggaaaagcca
atggcaatcgcgcaagagccaaaagaaagtcccacggaggctggcataaaggagaccaag
ccgcttgaagttcctgagcagaaggccaaagcaaagagtcccgagaagccggcaaccgtt
gcggagacagtattgcagcacgtacatgctcctgtgaatacggaaaagatctccacggaa
gaaagtaaactggagttggatgtgcactacttaaagctttcgccggactccgcgctcaat
ccaccagtggcctcagtgcagaaaccagtgcccgagcctccagctccgaaggagaaagct
aaagacctccaggccgctcagccaagcgaagccttgcagaagcaaccagaaatagagatg
gtcaaaaaaaccgaaaccaaaaccgaaacccctgtatctaatccgccatcaaaccgtact
gatgtttcctctctcgtcgagcaaccagttaaggctgcgccagaaaaagtggagcagcct
atggtcaaagaagctgtcgacatcaaagataaggcactcaaaaaacctgtgccagatgtg
cctgtcgtaaagccagaggctactagctgcgaaaagaaaatcgatcacagcaagacgaaa
gtgtttcacgaaaaggaagccatcaaaaccgatcaacaactagtgcaggttaaggaggag
gaaaagtcaaatgcgagagcgccatcggcacccattcccattcgggacaagatccaacta
aagggtaacgaacacgcccagttgcagaactccattccctcccagttcccactgaatcag
atgccgaactatcacacttcgcagtactggcagtgggaatactatggctacaatctctct
cacctggacgcatcgcagaagggacagaagcagttccacaaggacctggccacgacaatg
gcgtacacgcacaactttacgcaaaacctttatcagtccgccaatctggccatgcagcac
gcccatcaccagatgcaccagaccaaggagaagcacaaggtggagcgcaagaacagcggc
aagaaggaggagcagaacaaggtggtgtccagtgtcaatgtggtcagcacggctcgcgag
gatgcccatgtgcagcattgcaacgagtacgcggccaacaaccaggcggccttgtacaac
cagaaatgcgcaagtcagcagaagcaggcgcaacaaatgaagtctctggccaatgtccag
aacccagtgccccggcagagcaactccaacgcgccagagtcgacggttcttatgcctaat
ccagtgatttcccaggcgggatctgtgccggccaagcaaaaagtcgaacacggagtcaac
tcgacatcggtcatttcgcgcgagggaaagctcaacaagattgggcattctaacattcac
gccaccgcccagcacgctaatcttcaagtgggaggcggccagtccgacgtcaacccgaac
atggtttacaacacggagtcctcggcgaattcggccatgcagcactacgattgcggaatc
agtgcccagatcaacatggactcgccggccaatattggctccgccatcgcgcacggtcct
caggagatctcagccacgtccaatgtgcacatgcatcagccgcacaggcagttctctgac
tgctccatgcagaaccagccggtaacgacgcccatgcacatgtccatccaaaactcccac
atgcagcagcagaacaacttgaatttgaatctggcgccagaaggctcgtcaaatattaac
ctcttaagtaatccacagcaccagcaccagagcaggaaactcaatgcccaggcggacatt
gcagttagctcaccgacaccttcgcacagagccacgacgcccaagcaaattcggagcgga
aatacccagcaacgcgacgctaagaacgcggcgccacccacaaccacaacaaatactcat
catcagattccccagggcggagcagcggcaaatatttccaagtcgcatcacgactccttg
cacaacctgcagttctcgcagcacggacaccagcagaacatgcagcccatcgactacgtg
cccatcccgcaaatcagtcagaacttctcggcgaatccctcgaactatgacatcgtgggc
atgccggcggtgatccagcagcggatgtcactgaacggatcggtgcactcgctggccaat
tcgcaccagcgcatcgagcagccatcgtcagcgtgtgccgtcaataacttttacttgcaa
aacaacatgccggcagctgagaacgcgcctcgtgtgccggtctccagttctctgggcggt
ccgccgacggcgggtaacaatgatcagcggcaggcaggtcaggactcgataaccacggcg
aatagtagtggcgcaacagcttcgctggcgggcaatctgtgtagcctgtccaagctgcag
cagctgaccaattgtctggagagccagccgtgtaacacgtcaccgggggcccaggtgaat
ctggcgccctctccgcaccatccaattccgcccaactcgacccctccgccgcacctgctc
atgcagaacagaaacatctccacgccacccaacatgctgcaaacgcaggtaacgccgctg
cagtacaagtactatccgggcaacatgaacatcccgccaatcacgtcggcgcaaaacacg
agtcggaacacccgcaacacaccctccgccccggtgcagcacacgtcgacgccgatgggc
agcggtaacaataggaccgccaatgtccacatcagcccgaacctgatggccccatacgga
gcgatcaacagctaccggatgtcgccgcagcaatccccgcccactggaagctacagctcg
ggaggcgactaccccaactcgcagattccgatgcagatgatgaatatgcaatctcagtac
caggatgcctgcgtgctgcagcgaggcactccatcgaacccgatgtaccccacgtattcc
ccctacttacctctcaacggttctattcgcagataa

DBGET integrated database retrieval system