KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11491Help
Entry
Dmel_CG11491      CDS       T00030                                 

Gene name
br
Definition
broad
Orthology
K02174  
broad
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Class
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dme04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:2B3-2B4; X:1-0.28 cM
AA seq 880 aa AA seqDB search
MDDTQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFREL
LKSTPCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQA
EDTHSHLAQIQNLANSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAV
PSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRLRGSDNSLPLSGAVGSGSNNNSPD
LPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGN
GISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSNDSTGEHDANRSSSG
DGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPSALLGLNTQL
QQSGDLAVSPQGGSTGSLLSGVIVPGGSGGTPSNSSSNNNNNNSNNQQQKVEQQSSPHQL
LQQQHHSTPHTNSPQLKQEQPKSGGGSCKSSDLHIAAGSERSLSRSSQGMPDAGGHSATP
SPTAAYHKRERERERERERERERERERSLDHERDLERPGGTGSPPPPPPSHHSHFGQHPL
SLLPSHHQLHATHHELSAAAAHHAHAHAHAAHAHALARAGSPMEHHHLLHHRRASLSPSG
AVSSASGAGGRGGGAGGPGGPGGSLLSSVRAQDVAQANRLLLPLPLNACHRCDVCGKLLS
TKLTLKRHKEQQHLQPLNNAVCNLCHKVFRTLNSLNNHKSIYHRRQKNHHSYFHHGAGVS
QAGSPGSRLHQSLSSLSAAAAAANNSVNVGGGSVGGAGGNAVAAAAAAAAAAAELLLSPI
VGAAAVAGGTASSTLQLAAAHQQQQQQSSPGIVKPCMDFL
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacacagcacttctgcctgcgctggaacaactaccagagcagcataacctcg
gcgttcgagaatctgcgcgacgacgaggccttcgtggatgtgaccctcgcctgcgaggga
cgcagcatcaaggcacaccgcgtcgtcctctccgcctgcagtccctacttccgcgagctg
ctcaagagcacaccctgcaaacacccggtcatactgctgcaggatgtcaacttcatggac
ctgcacgccctggtggagttcatctaccacggcgaggtcaacgtgcaccagaagtccctg
cagtccttccttaagaccgccgaagtgctgcgcgtctctggactcacgcagcagcaggca
gaggacacacacagccatctggctcagatacagaacctggccaattccggcggccgcacg
ccgctcaacacgcacacccaatcgctcccacatccgcaccatggctcgctacacgacgac
ggcggctcctcgaccctcttcagccgccagggagcgggttcgccaccgccgacggcggtg
ccatcgctgccctcgcacatcaacaaccagctgctgaagcgcatggccatgatgcaccgc
agcagtgccgccgccgccgccgaggagacctcccacgcctttaagcgtctgcgcggctcg
gacaacagcctgccgctgtccggcgccgttggcagtggcagcaacaacaacagccccgac
ttgccgccgcttcatgcgcgcagcgcctcgccccagcagactccggccgacttcagtacg
atcaagcaccacaacaacaacaacacgccgccgctgaaggaggagaagcgcaacggaccc
acaggcaacggaaactctggcaacggcaatggcaatggcaacggagcgagcaacggcaac
ggaatctccatcagcgacaagctgggcagcctcacaccttcgccgctggctcgagcgggc
gccgatgatgtcaagtcggagcccatggacatggtctgctctaacaacaatgccaatgcc
aacgacgaacacagcaacgactccaccggcgagcacgatgccaatcgctccagtagcggc
gacggcggcaagggatccctgagctccggcaacgacgaggagatcggcgacggactcgcc
tcccatcatgccgcccctcagttcatcatgtcgccggcggagaacaagatgttccatgca
gccgccttcaactttcccaatatcgatccctcagcgttgctaggtctcaacacacagttg
cagcagtccggtgacctcgccgtgtcccctcaaggtggcagcaccggcagcctactcagt
ggcgtcattgtgcccggcggtagtggtggcacccctagtaatagtagtagcaacaacaac
aacaacaacagcaacaatcaacaacaaaaagtagaacaacagtcatcaccacaccaactc
ctccaacaacaacatcattccacaccacataccaacagtccacaactgaagcaggaacaa
ccgaaatcgggcggcgggagctgcaagtccagcgacctgcacattgcagcgggtagtgag
cgcagcctctcccgatcctcccaaggaatgccagacgccggcgggcacagtgccacgccc
tcgcccaccgccgcctaccacaagcgcgagagggagcgcgaaagagaacgcgaacgggag
cgggagcgcgagcgggaacgctcgctcgaccatgagcgcgacttggagaggccaggcggc
accggctcaccaccaccgccgccgccgtcgcaccactcacatttcggccagcacccattg
tcgctgttgcccagccaccaccagctgcacgcgacccaccacgagctgagcgccgctgcc
gcccaccacgctcacgcccatgctcatgccgcccacgcccatgccttggcacgcgccgga
tcgcccatggagcaccatcacctgttgcaccacagacgcgcctcgctctccccctcgggg
gccgtttcctcggccagcggagcgggtggacgcggaggcggcgctggcggaccgggagga
cccggcggcagcctgctgtcatcagtgcgcgcccaggacgtggcccaggccaatagactc
ctcctgcccctgcccctcaacgcctgccaccggtgcgacgtgtgcggcaaactgttgagc
accaagctcacgctgaaacgccacaaggagcagcagcacctgcagccgctgaacaacgcc
gtttgcaacctgtgccacaaggtcttccgcacgctgaactcgctgaacaaccacaagagc
atctatcatcgccgccagaagaaccaccactcgtatttccaccacggcgccggggttagc
caagcgggcagtccgggcagtcggctgcatcagtcgctcagttcgttgagcgcagcagca
gcggcggccaacaatagcgttaatgtgggcggtggatcggtaggcggggccgggggcaat
gcagtggctgctgctgcagccgcagctgccgcggcggccgaactgcttctctctccgatc
gttggcgccgctgccgtggccgggggtacggccagctccacgctccagctggcggcggcg
caccagcagcagcagcaacagtcgtcgccgggcattgtcaaaccgtgcatggacttctta
taa

DBGET integrated database retrieval system