KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11567Help
Entry
Dmel_CG11567      CDS       T00030                                 

Gene name
Cpr
Definition
Cytochrome P450 reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:26C3-26C3
AA seq 679 aa AA seqDB search
MASEQTIDGAAAIPSGGGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPTRSYSIQP
TTVCTTSASDNSFIKKLKASGRSLVVFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEE
CDMEELLQLKDIDNSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLSGLNYAVFGLGNK
TYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGIEGG
GEEVLIRQYRLLEQPDVQPDRIYTGEIARLHSIQNQRPPFDAKNPFLAPIKVNRELHKGG
GRSCMHIELSIEGSKMRYDAGDHVAMFPVNDKSLVEKLGQLCNADLDTVFSLINTDTDSS
KKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEKEKELLRSMASISPEGKEKY
QSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISSSAKLHPTDVHVTAVLV
EYKTPTGRINKGVATTYLKNKQPQGSEEVKVPVFIRKSQFRLPTKPETPIIMVGPGTGLA
PFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTLNLKAAFSRDQ
GKKVYVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKILSTKGNMSEADA
VQYIKKMEAQKRYSADVWS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgagcaaacgattgatggagcagccgcaattcccagcggcggcggcgacgaa
cccttcctgggactgctggacgtggccctattggcggtgctaatcggcggcgcagccttc
tacttcctgcgtagccgcaagaaggaggaggagccaaccaggagctattccatacaaccc
accacagtgtgcaccaccagtgcgtcggacaattcgttcatcaagaagctcaaggcatcc
ggacgcagtctggtcgtcttctatggctcacagaccggaaccggcgaggagttcgccggc
cgtctggccaaggagggcattcgttaccgtctgaagggcatggttgccgatcccgaggaa
tgcgacatggaggagctgctgcagctgaaggacatcgacaactcgctggcggtcttttgc
ctggccacctacggcgagggagatcccactgacaacgccatggagttctacgagtggatc
accagcggcgatgtcgatctgagcgggctaaattatgcggtctttggcttgggcaacaag
acctatgagcactacaacaaggtggccatctatgtggacaagcgactggaggagctgggc
gccaaccgggtctttgaactgggactgggcgacgatgatgccaacatcgaggatgacttc
atcacgtggaaggatcgcttctggcccgccgtgtgcgatcacttcggcatcgagggcggc
ggcgaggaagtgctcatccgccagtaccgtttgctagaacagccagatgtgcagcctgac
cgcatttacacgggagagatcgcccgcctgcactcgattcagaaccagcgcccgcccttc
gacgccaagaacccattcctggcccccatcaaggtgaaccgcgagctgcacaagggcggt
ggccgctcctgcatgcacattgagctgagcatcgagggttccaagatgcgctacgatgcc
ggagatcatgtggccatgttccctgttaacgacaagagtctggtggagaagctcggccag
ctgtgcaacgccgatctggatactgtgttctcgctgatcaacaccgatacggacagcagc
aagaagcacccattcccttgccccactacgtaccgcaccgctctgacccactacctggaa
attacggccataccccgcacacacatcctcaaggagctcgctgagtattgtactgacgag
aaggagaaggagttgctgcgcagcatggcctccatcagtcccgaaggaaaggagaaatac
cagagctggatccaagacgcctgtcgcaacatcgtccacattctggaggacatcaaatcc
tgtcgcccacccatcgatcacgtttgcgagctgctgccccgcttgcagcctcgttactac
tccatctcgtcgtctgctaagctgcaccccactgatgtccacgttacagccgttctcgtg
gagtacaagacgccgacgggacgcatcaacaagggcgtagccaccacatatctgaagaac
aagcagccgcagggcagtgaggaagtaaaggttccggtattcatccgcaagtcgcagttc
cgtttgcctacgaagccagagacacctatcataatggtgggtcctggcactggcttggcc
cccttccgcggattcattcaggagcgacaattccttcgcgatgagggcaagaccgtgggc
gagtcgattctctacttcggttgccgtaagcgcagtgaggactacatctacgaatccgag
ttggaggagtgggttaagaagggcactctcaacctgaaggccgccttttctcgtgaccag
ggcaagaaggtctacgtgcagcatctgctcgagcaggacgcagatcttatatggaacgtg
attggcgagaataaggggcacttctacatatgcggtgatgcaaagaacatggccgtggac
gttaggaacattttagtgaaaattttgtccactaagggtaacatgagcgaggctgacgcc
gtgcagtatatcaagaagatggaggctcagaagcgctactcggccgatgtctggagctaa

DBGET integrated database retrieval system