KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1165Help
Entry
Dmel_CG1165       CDS       T00030                                 

Gene name
LysS
Definition
Lysozyme S (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61F4-61F4
AA seq 140 aa AA seqDB search
MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVG
PANSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGW
SAWAVWHYCSGWLPSIDECF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttctttgctctggtgctcctggccattgccgctcctgccctggcaggtcgc
accctcgaccgctgctcgctggcccgcgagatggccgacttgggagttccccgcgaccag
ctggacaagtggacctgcattgcccagcacgagagtgactaccgcacctgggtggtggga
cctgccaactccgatggctccaacgactacggaatcttccagatcaacgatctgtactgg
tgccaggccgacggacgcttctcctacaacgagtgcggcttgagctgcaatgccctcttg
accgacgacatcaccaactctgtccgttgcgcccagaaggtcctcagccagcagggatgg
tccgcctgggccgtctggcattactgcagcggatggttgccgtccatcgatgagtgcttc
taa

DBGET integrated database retrieval system