KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11811Help
Entry
Dmel_CG11811      CDS       T00030                                 

Definition
CG11811 gene product from transcript CG11811-RA (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG11811
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dmel_CG11811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67E6-67E7
AA seq 233 aa AA seqDB search
MISFLFIVNRALSSSSSSSSAAASLTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFP
STFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVR
EIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRL
NAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQQKQGVSVNLN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgggcgctcagcagcagcagcagcagtagcagt
gcagcggcatccttaacgagcaagaagatgaccgcccccgggccacgcccccttgtccta
tgcggtccctcgggatccggaaagagtacgctgctgaaaaggctattcgccgaattcccc
agcacctttggcttcagcatatcgcacaccacgcggaagccgcgtgagggcgaggagcat
ggcgtgcactactattttgtggaacgtccggaaatggaggcagccatcgctggcgacgag
ttcatcgagacggccgagtttacgggcaatctttatggaacgagcaaggcggcggttaga
gagatccaggcacagggacgggtctgcatactggacatcgaacagaagggagtggagcag
atcaagcgtacggatctcaatcccatactgatattcaacaatccaccgagcatcaaggag
ctggagcgacgacttcgcaaacgtggctccgaaacggaggagtcgctgagcaagcgcctc
aatgccgctcaggtggagctcgattatggtttgacgcccggcaacttccacaagatcatc
aataacgtggacatcgatgtggcctacgaggaattccgcaactttgtcgtccaggaactc
aaggagcagcagaagcagggagtatcagttaacttgaattaa

DBGET integrated database retrieval system