KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11833Help
Entry
Dmel_CG11833      CDS       T00030                                 

Gene name
Ssl2
Definition
(RefSeq) strictosidine synthase-like 2
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Metabolic pathways
Brite
Enzymes [BR:dme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     Dmel_CG11833 (Ssl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 414 aa AA seqDB search
MGFLAALLKTSLFLVLFLGSLFLLPVLYPSTTFPFEQYFIKPARDLNGTLELNNHLNGAR
KLWKDQIFGPECLIVLEDKIYTGIHSGEVIRLNNEESVQPITKIGQPCDYIFDDELCGYP
VGLALDTQGNNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISR
QGDIFWTDSFSEDFVFAAFANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIIL
AETTAMRLRRYYLKGSRAGESEVFVEGLPGCPDNLTADEEGIWVPLSVASDSQNPNLFAV
LAPYPRLRSFLARLVALMRLPLRVLNHIYPNDIAARLFHSFNDLVIRNAPKRSTVVRVDW
NGNIVRSLHGFDRSASGISHVLEVKGHLYLGSPFNHYVAKVKLPEEGLKSVKGN
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttgctgcattgcttaaaaccagcctgtttttggtcctattcctggggtcc
ttgtttctgctacctgtcttatatcctagcaccactttccccttcgaacagtattttata
aagccagctagagatctgaatggaacgctggagctgaacaatcacttaaatggcgcccgg
aagttgtggaaagatcaaatatttggacccgagtgcctcatagtactcgaggacaagatt
tacacaggaattcacagcggcgaggttattcgactaaacaatgaggagtcggttcaacct
atcacaaaaatagggcaaccttgtgattatatatttgacgatgagttgtgcggctatcca
gtgggtttagccctggacacccagggaaacaatcttattgtatccgatgcatactacggc
atatggcaagtcgacttggaaacgaagaagaagactgtgctggtgccggcggagcagatc
cttcctggcaagggtgcaaaccgtcgggctaagctgttcaattcgctggtaattagccgc
cagggtgacatattctggacggattccttttcagaggactttgtctttgctgcgttcgcc
aacccgtcgggtcgacttttcaggtacgatcgcgtaaagaagacaaacgaggtactgctc
gatgagttgtcctttgccaacggcttggccttaagtcccagtgaggatttcattatcctt
gccgaaacaacggccatgcggctgaggagatattatctcaaaggatcaagagccggtgaa
agcgaagtgtttgtggagggtttgcccggctgcccggataacctcactgcggatgaagag
ggaatctgggtgcccctgtctgtggcttcagatagtcagaatcccaatttgttcgccgtg
ttggcgccctatccgaggcttagatcttttttggctcgtttggtggctctaatgcgactt
ccccttcgagttctgaaccatatatatccaaatgacattgcggctcgtctttttcactcc
tttaacgatttggtcatcaggaacgctcccaagcgtagcactgtggtgcgtgtggattgg
aatggaaacattgtgagatccctgcatgggtttgacagatcagcttcgggcatatcccac
gtgctggaagttaagggtcacttatatctgggatcgcctttcaatcactatgttgccaaa
gtaaaattgcccgaagagggattgaagtccgtaaaaggaaattaa

DBGET integrated database retrieval system