KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11924Help
Entry
Dmel_CG11924      CDS       T00030                                 

Gene name
Cf2
Definition
Chorion factor 2
Orthology
K02215  
chorion factor 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG11924 (Cf2)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    Dmel_CG11924 (Cf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:25B1-25B1
AA seq 431 aa AA seqDB search
MDTLKTAFLPNLSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLD
GGHPQAQQHPKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQ
PNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQL
QAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPP
LTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLV
GTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFT
QSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSA
LTVHTTKLHPL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggacaccctgaagacagcctttctgcccaatctcagcatggaccccaatgtgcacgtg
tcgccgcactattgtcccatgtgtcaccagcagtttgagcgaccgcagcacgtcgcggat
cacatgcagctgtgccacgggatcacgctgaacgcccagggagccattgccacgctggac
ggcggtcatccgcaggcacagcagcaccccaagctcagccacccctgcttcaattgtgat
gaaaagtttggcaacgccgtcgatttagacgaacaccatcggctggcccatcagacgccc
gccttcctgtcccgctgccttatgtgcagcatctatggcatccactcggccacccagcag
cccaacgagtacaaatgcacgcagtgcggctccatttgcaccaccgccatgctggctgcc
ggacagcagggctttatggaacagcaggaggcggcggtgacgcccgacgatcagctgccg
gcaatggcgccccgtgatatgagactgacgcccgaggagcagcaccatcagcagcaactg
caggcggagcaccaccatcagcaacagcaccaacaacaacaacagcagcagcagcagcag
caggaactgctggagcagcagcagcgtgaaatgcaggagcaggcgcaacagcagcaggtg
caccatcaccagcaggatcaggatctcgccggcgaccaggtggcgctgaaggtgccacca
ctcaccgtcaagctaaacaagaacgccaacggtggcgccattgtgtcgcatccgcaggtc
attatcaaggaggagccactcagcctgagcgacagtggtgatgttgtcaactctgtgcct
gtctatgccatacaagccaatcccggtgtacccgctccggccagttcgggtgtgctagtc
ggcacacaaacggtacctgccgatctggcgcacaagatccggcacaaatgtccggattgt
ccaaagaccttcaagacgcccggcacgctggccatgcaccgcaagatacacacaggcgaa
gcagacgccacgcccaaagaacgcccctacacgtgctcctactgcggcaagtccttcact
caatcgaatacactaaaacagcacactcgcatacatacaggagagaagccgttccactgc
ggttactgcgagaagtccttcagcgtgaaggactatctgaccaagcacatacggacgcac
accggcgagaagccgtacacctgtccgtattgcgacaagcgcttcacgcagcgcagcgcc
ctcactgtgcacacgaccaagctgcatccgctctag

DBGET integrated database retrieval system