KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11924Help
Entry
Dmel_CG11924      CDS       T00030                                 

Gene name
Cf2
Definition
(RefSeq) chorion factor 2, isoform A
  KO
K02215  chorion factor 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG11924 (Cf2)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    Dmel_CG11924 (Cf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_2 zf-Di19 zf-C2HC_2 zf-met DUF4746 EPL1 OmpH SID-1_RNA_chan zf-C2H2_11 zf-CHCC eIF-3_zeta zinc_ribbon_9
Motif
Other DBs
NCBI-GeneID: 33692
NCBI-ProteinID: NP_523474
FlyBase: FBgn0000286
UniProt: P20385
Position
2L
AA seq 510 aa AA seqDB search
MIKSTTNPQEQRLPRPEDQSPAPPPPPPSSATTSTAAPATPTHQVATVIANMDTLKTAFL
PNLSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQH
PKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQC
GSICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQ
HQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNA
NGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADL
AHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHT
RIHTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHT
GEKPYTCPYCDKRFTQRSALTVHTTKLHPL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgataaagtccaccacgaatccacaggaacagcgtctgccacgccccgaggatcagtcg
ccagcgccgccgccgccgcccccctcctcagccaccacctccaccgccgccccagccacg
cccacgcaccaagtggccaccgtgatagccaacatggacaccctgaagacagcctttctg
cccaatctcagcatggaccccaatgtgcacgtgtcgccgcactattgtcccatgtgtcac
cagcagtttgagcgaccgcagcacgtcgcggatcacatgcagctgtgccacgggatcacg
ctgaacgcccagggagccattgccacgctggacggcggtcatccgcaggcacagcagcac
cccaagctcagccacccctgcttcaattgtgatgaaaagtttggcaacgccgtcgattta
gacgaacaccatcggctggcccatcagacgcccgccttcctgtcccgctgccttatgtgc
agcatctatggcatccactcggccacccagcagcccaacgagtacaaatgcacgcagtgc
ggctccatttgcaccaccgccatgctggctgccggacagcagggctttatggaacagcag
gaggcggcggtgacgcccgacgatcagctgccggcaatggcgccccgtgatatgagactg
acgcccgaggagcagcaccatcagcagcaactgcaggcggagcaccaccatcagcaacag
caccaacaacaacaacagcagcagcagcagcagcaggaactgctggagcagcagcagcgt
gaaatgcaggagcaggcgcaacagcagcaggtgcaccatcaccagcaggatcaggatctc
gccggcgaccaggtggcgctgaaggtgccaccactcaccgtcaagctaaacaagaacgcc
aacggtggcgccattgtgtcgcatccgcaggtcattatcaaggaggagccactcagcctg
agcgacagtggtgatgttgtcaactctgtgcctgtctatgccatacaagccaatcccggt
gtacccgctccggccagttcgggtgtgctagtcggcacacaaacggtacctgccgatctg
gcgcacaagatccggcacaaatgtccggattgtccaaagaccttcaagacgcccggcacg
ctggccatgcaccgcaagatacacacaggcgaagcagacgccacgcccaaagaacgcccc
tacacgtgctcctactgcggcaagtccttcactcaatcgaatacactaaaacagcacact
cgcatacatacaggtgagaaaccatttagatgtggctattgtggcagggcgttcactgtt
aaggattacctgaacaaacatttaacgactcacacgggagagaagccgttccactgcggt
tactgcgagaagtccttcagcgtgaaggactatctgaccaagcacatacggacgcacacc
ggcgagaagccgtacacctgtccgtattgcgacaagcgcttcacgcagcgcagcgccctc
actgtgcacacgaccaagctgcatccgctctag

DBGET integrated database retrieval system