KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11943Help
Entry
Dmel_CG11943      CDS       T00030                                 

Gene name
Nup205
Definition
Nucleoporin 205kD
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG11943 (Nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:18F4-18F4
AA seq 2067 aa AA seqDB search
MDAVIEDMWTPYKHLYNTFQTAVSNRSGFTSDLEQCLKKYKHNFSNLLRNPPRSEKSRNL
LRNALNEGVPMQGHSRKTKMSQDLADEAVILSDMFDLDEGFAVELLCTAQRQQKHHPGLS
RGLVAVLLYYDGRKAISCTLRDMFQVVSGVSWNTELPKEITGLVTNYAESLVDGSGILGR
LLQLLEEMDVDKECAMLTTNRAFGSKKHQNQVLGLYEDIQQALAMALFNWSAQRGLPRHI
AIRLMHQLANRKNHDAGGNMDDVTLIMLMALLYAYDTSMLLVTEEPNEHTTRLPIFSDRE
FAECFLEELYAQSSWQAPRLNAIIAYSFGLTLASLRHAPLQLQATAISIINRDEMLIDEA
LGAQVFVFFHSLLLEKDLVYSTQFFYRRVHLLITDFIDFMNSKVSELRGRADESSHTIIS
FLNEGLEPPPNLDSNFELLMLCVAKMHGDPRVTIRLCNEYWGPGDPNGSTAFKNTSRSVS
LFKFISLASDLLPQTLFKAYLKMISGLTRTDFSARCAFNMLRVPQMATGGKYAVSWDHFF
TTLGNYYTSMRNDFNTNIGMSGETIYRTRSTPKAITQREAEHLVAVMGIIQAVAEHDEVS
RIMICDHPNWQTPQVLLGLVACATPLFLKAEILHTLAALAKSKETARVIWFHLEASQIIP
TVPVSRSYAQCSLLEEMEQIESRSEQYNLTRGILQLLYTLMTTNLPKSLGAGQRTPAYEG
YLKSMINSVLLKFYNRAYKVPSEKWQVGAQCLKLLYYLLATYRPSAMDFLETVDEPPYPG
FHVMMQLQLKSEMLQLLLCIVEEVRERLDNYNRFQGKKLLEECSLYALLILEAALAKQNA
FFEAHSAANCPILLSGLNRMLLDLNPRSRKPDHVLNIIKYVTYNSWLPRHALAAIKILAS
VTQLPNVSTQILSMYGQGSNEKLEIRQGFVECLEMEVCVGKHDDDLLDQLALNNHVPYLG
FGDDLDNEREMSGEREYSTIESQLELQAGDGALESKPASIELQLKEAIIKLFEMNLSQQL
PNFVYFLLGVDVLREFMANGRQHLAIEMQSSCVNSVVLLLEKYMDKQRHSDKYCEHTARI
VERIYHLFHGLCANRRTAETILRYFRLTCSDFLLRHLRSLPFRQHREDHVLHAMGHLLNC
VSIDVKLAAKHGQMTRFNQMCDILLIGNGMERSSHGLSMELGHSLISQPSSSFLAMDVLP
AGGSISAVAHGAGSASLGAPNTGVKSLKPSLLQETSQGLHVTRLLDILVLEAGTLSQPQL
EFFDGHLITQLLRDCEASAEAGANSRANLINVRKLYYILTDELYMVQSIIASGQRKAIST
EIMLLLNHAVNINRVRTQRCATLAFMAAWGQLVQVLFSNMPDAVLPATQRRQHIIDIVEK
VLIKVQPIQPIIEISVQVSETVLLLLANLRYCCYQAEDQSPEDLAAEDSLSNGNGNAIGN
DSQVNALCLGQRAIGTGSDGGSGGGRDIGSGGNSSNLRFILKNLVQWIMISEVKSQKLRI
NLYSSLLNCLRIAKRLRTDEHLEYQETLISRQESARTYNKEQRRDDRLRLKAMAAEVIGT
FGEKLIDTICHDAVTGHDVCRMLALACLDMISELQAVSTLCDFVASRGYLKHILESLDQS
STALCGILQPVPDHLRPLYVYESRMAFLTRMANSNVGARLLLTEQALGVLSNMKVYDQQP
DLKSSELNRNEPQTFLPSIDDRFRSILLPALSLCDAIVNSLGPRNNSAAVQVLNFLFAHI
DMVEAMLRSATPYMDLGHLQQVAVISNLFARASTHELTALEDSVQLDLRNRLGRVQQLMI
VVFGRFCVSEPTIRRMLQQDEEQQTNPTDDSKRLRVKYFLDIAANVSLYCRNVVTSHSKD
SMTSKYLLTTVINDVTLLTGKMSSKKLTTIMHTILNQLKGSIGYYLSQKSIADNLLQQRA
SLPNISFGPNGKQSYIELSQRYNEKRSELRQAVFIAEQNLYLLWIHLDFYLRNTIDYANE
NRNAINESNMDDDNDMSVLNASQEEIVQLKQLLISTFNETFCTQLINASEDYSIKCKGFN
GSLLRRIKALVQFAPITANDVNSSFDS
NT seq 6204 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtaatcgaggacatgtggacgccgtacaagcatttgtacaacacttttcag
accgcggtgtccaatcgcagtggcttcacctcggatctggagcagtgcctcaagaagtac
aagcacaacttcagcaacttgctgcgcaatccgccgagaagcgagaagagccgcaatctc
ctacgaaatgccctcaacgaaggcgtcccgatgcaggggcattcgcgaaagacaaagatg
tcacaggacctggccgacgaggcggtcattctgtccgacatgttcgatctggacgagggt
ttcgccgtggagctgctgtgcaccgcacagcgccagcagaagcatcatcccggcctgtcc
agaggccttgtcgcggtgctgctctactacgatggacgaaaggccatcagctgcacgctt
cgcgacatgttccaggtggttagcggcgtctcgtggaacaccgaactgcccaaggagatc
accggtctggtcactaactatgccgagagccttgtcgacggctctgggatactgggacgc
ctgctgcagctgctcgaggagatggatgtcgacaaggagtgcgctatgctgaccacaaac
cgcgcgtttggctccaagaagcatcagaaccaggtgctcggcctatacgaggacattcaa
caggcattggcaatggccctgttcaattggtcggcacaacgcggcctgccgcgacacatt
gccattcggctgatgcaccaattggccaaccgaaagaaccacgacgcgggcggcaacatg
gacgacgtgaccctgatcatgctgatggctctgctgtatgcgtacgatacctccatgctg
ctggtcaccgaggaacccaatgagcacacaacccgacttccgatcttcagcgatcgcgag
ttcgccgagtgcttcctggaggagctgtacgcgcagagcagctggcaagcaccgcgcctg
aatgccatcattgcctacagcttcggactaacgctggccagcctgcggcatgcacctttg
cagcttcaggccaccgccatctcgatcatcaatcgcgatgagatgctcatcgacgaggca
ctgggagcgcaggtattcgtcttcttccacagcttgctgctcgagaaggatctggtctat
agcacgcagttcttctaccgccgcgtccatctgctcatcacggacttcatcgacttcatg
aactccaaggtgtcggagctgcgcggccgagcagacgagtcgtcacacacgatcatcagc
ttcctaaacgagggtctggaaccgccgcccaacttggactccaactttgagctgctcatg
ctgtgcgtggccaagatgcacggcgatccgcgcgtcaccatcaggctgtgcaacgagtac
tggggccccggcgatcccaacggctctacggcattcaagaacacctcgcgctcggtgtcg
ctgttcaagttcattagcttggccagcgacctgctgccacagacgctgttcaaggcctac
ctcaagatgatatccggacttacacggaccgatttctcggctcgatgcgccttcaacatg
cttagggtgccccagatggccaccggcggcaagtatgcggttagctgggatcacttcttc
accaccctgggcaactactatacttcgatgcgcaacgactttaacaccaacatcggcatg
agcggcgagaccatttaccgcacccgatcgacaccaaaggccattacgcagcgagaggcg
gagcatctggtggccgtaatgggcatcatacaggcggtggcggaacacgacgaggtctcg
cgcatcatgatctgtgaccatcccaattggcagacgccgcaggtgctcctgggcctggtt
gcgtgcgccacgccgctttttttgaaggcggagattctgcacacgctggctgccctggcc
aaatcgaaggagacggcgcgcgtcatctggttccacctggaggcctcgcagattataccc
actgtgcccgtgtctagaagctatgcccagtgcagtttgttggaggagatggaacaaatc
gagagccgttcggagcagtataacctgacgcgcggcatcctccaattgctctacacactg
atgaccaccaatctgccgaagagtttgggcgccgggcaacggacaccggcctacgaaggc
tatctaaagtccatgataaattcggtgttgctcaagttttacaatcgcgcgtacaaggtt
ccctccgagaagtggcaagttggcgcccagtgcctgaaactgctctactacctactggcc
acctatcggccgtccgcaatggattttctggagacagtcgatgaacctccctatccgggc
tttcacgttatgatgcagctgcagctgaagtccgaaatgttgcagctgctgctgtgcatt
gtggaggaggtgcgtgagcggctggacaactacaatcgctttcagggcaagaagctactc
gaggagtgctcattgtacgcactgctgatcctggaagccgcattggcgaaacagaacgcc
ttctttgaggcccactcggcggccaattgccccattttgctgtcgggcctgaatcgcatg
ctcctggatctgaatccacgcagtcgcaagcccgatcacgtgctgaatatcattaagtat
gtaacctataatagctggctgccgcggcacgccctggccgccattaagattctggcttcg
gtcacccagctgccgaatgtctccacccagattctcagcatgtacggtcagggcagcaat
gagaagctcgagattcgtcagggtttcgtcgagtgcctggaaatggaggtgtgcgtgggc
aagcacgacgacgatttgttggaccaactggccctcaacaatcacgttccgtatctggga
ttcggcgatgatctggacaatgagcgagagatgagcggggaacgcgaatattcaactatt
gaatcgcaactggagctgcaggcgggggatggcgcgctggagagcaaaccggctagcatt
gagctgcaactgaaagaggccattatcaagctgttcgagatgaatcttagccagcagttg
cccaactttgtgtacttcctgctcggcgtggatgtgctgcgcgaatttatggccaacgga
cggcagcacctggccatcgagatgcaaagctcgtgcgtgaactccgtagtgctgttgctg
gaaaagtacatggataaacagcgtcacagcgataagtactgcgagcacacggcgagaatc
gtggagcgcatttaccatctgttccatggactctgcgccaatcgccgcaccgcggagacg
atactgcgctacttccggctaacgtgcagcgacttcctgctgcgtcacctacgctcgctg
cccttccggcagcatcgcgaggatcatgtgctgcacgccatgggccacctgctcaactgc
gtctctatcgatgtcaaactggcggccaaacatggccagatgacgcgcttcaaccagatg
tgcgacattttgctaattggaaacggaatggagcgttcatcccatggcctgtcgatggaa
ttgggccacagcctgatttcacagccgtcgtcgtctttcctcgccatggatgtgctaccg
gccggtggatcgataagtgccgtggcacatggggctggttcggcgtctctcggagctcca
aacactggggtcaaatcacttaagccatcgctgctgcaggagacatcgcagggactgcat
gtcacccgactgctagatattctcgtcctggaggcgggcacgttgagccagccgcagctg
gagttcttcgacgggcatctgatcactcaactgctgcgcgactgcgaggcatccgccgaa
gctggcgccaattccagggccaacttgatcaacgtgcgcaaactgtactacattctcacc
gacgagctgtacatggtgcagagcatcattgccagcggccagcggaaggccatttccacg
gaaatcatgctgctgctcaatcacgccgtcaacataaatcgcgtgcggacacagcgctgc
gccacgctggccttcatggcagcatggggtcaactggtgcaggtgctctttagcaacatg
cccgatgccgtgcttccggcgacgcagcgtcgccagcacatcatcgatatcgtcgagaag
gtactcatcaaggtgcagcccatacagcccatcatcgagatatccgtacaggtgagcgag
acggtgctgctgctgcttgccaatttgcgctactgctgctaccaggccgaggaccagagc
cccgaggatctggccgccgaggattcgctcagcaatggcaatggcaacgccatcggcaac
gattcgcaggtgaacgcattgtgtctgggccagagggcaatcggaactggttcggatggc
ggcagtggaggtggacgggatatcggttccggtggcaacagcagcaatctgcgattcatt
ctcaagaacctcgtccagtggatcatgatcagtgaggtgaagtcgcagaagctgcgcatc
aatctgtacagttcgctgctgaattgcctgcggatcgcgaagcgactgcgcaccgacgag
catctggagtaccaggagacattgatttcgcgccaggagagtgcacgcacgtacaacaag
gagcagcggcgcgacgatcgcctgcggctgaaggccatggcggcggaagtgattggcacg
ttcggcgagaagctgatcgacaccatctgccacgatgcggtgaccggccacgatgtgtgc
cgcatgctggcgctggcctgcctggacatgatctccgagctgcaggcggtgagcacgcta
tgcgactttgtggcatcgcgtggctacctcaagcacatactggaaagccttgatcagtcc
agtacggcgctttgcgggattctgcagcccgtgccggatcacctgaggccgctctacgtc
tacgagtcgcgcatggccttcctcacgcgcatggcgaacagcaatgtgggagcccggctc
ctcctcaccgagcaggcgctgggcgtgctttcgaatatgaaggtctatgaccagcagccc
gacctgaagtccagcgaactgaatcgtaacgagccgcagaccttcctcccgtccatcgat
gaccgcttccggtcgatcctcctgccggcgctgagcctctgcgatgccattgtcaactcg
ctgggtccgcgcaacaactccgccgccgtgcaggtgcttaactttctgttcgcccacatc
gacatggtcgaggccatgttgcgctcggccacgccgtatatggacctcggccacctgcag
caggtggcggtcattagcaatctgtttgcccgcgcctccacgcacgagttgaccgcgctg
gaggatagcgtgcagctggatttgcgaaatcgcctgggccgcgtgcagcagctgatgatc
gtggtgttcggacgcttttgcgtaagcgagcccaccattcgtcgcatgctgcagcaggat
gaggagcagcagaccaaccccaccgatgactcgaagaggctacgtgtcaagtattttctg
gatatagcagccaacgtgtcgctctactgccgcaacgtggtcaccagccattcgaaggac
agcatgacctccaaatacttgctgaccaccgtgatcaatgatgtaacgctgctcactggc
aaaatgtccagcaaaaagctgacgaccatcatgcacaccatcctcaatcagctgaagggc
tccatcggctactacctttcgcagaagtcgatcgccgacaatctcctccagcaacgcgcc
tccctgcccaacatcagctttgggcccaacggtaaacaaagctacatagaactgagccag
cgatacaacgagaagcgcagcgaactgaggcaggccgtcttcattgccgagcagaatctg
tatctgctgtggatccatctggacttctatctgcgcaacaccatcgactacgccaacgaa
aacaggaacgccatcaacgagagcaacatggacgacgacaatgacatgtccgtgctgaac
gcctcgcaggaagagatcgtgcagctcaagcagctgctcatctccacattcaacgagaca
ttctgcacgcagctaatcaacgccagcgaggattactcgattaagtgcaaaggcttcaat
ggctcgctgctgcgacgcattaaggcgctcgtccagttcgcccccatcactgccaacgat
gtcaattccagcttcgattcgtag

DBGET integrated database retrieval system