KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11943Help
Entry
Dmel_CG11943      CDS       T00030                                 

Gene name
Nup205
Definition
Nucleoporin 205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dme03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:18F4-18F4
AA seq 2067 aa AA seqDB search
MDAVIEDMWTPYKHLYNTFQTAVSNRSGFTSDLEQCLKKYKHNFSNLLRNPPRSEKSRNL
LRNALNEGVPMQGHSRKTKMSQDLADEAVILSDMFDLDEGFAVELLCTAQRQQKHHPGLS
RGLVAVLLYYDGRKAISCTLRDMFQVVSGVSWNTELPKEITGLVTNYAESLVDGSGILGR
LLQLLEEMDVDKECAMLTTNRAFGSKKHQNQVLGLYEDIQQALAMALFNWSAQRGLPRHI
AIRLMHQLANRKNHDAGGNMDDVTLIMLMALLYAYDTSMLLVTEEPNEHTTRLPIFSDRE
FAECFLEELYAQSSWQAPRLNAIIAYSFGLTLASLRHAPLQLQATAISIINRDEMLIDEA
LGAQVFVFFHSLLLEKDLVYSTQFFYRRVHLLITDFIDFMNSKVSELRGRADESSHTIIS
FLNEGLEPPPNLDSNFELLMLCVAKMHGDPRVTIRLCNEYWGPGDPNGSTAFKNTSRSVS
LFKFISLASDLLPQTLFKAYLKMISGLTRTDFSARCAFNMLRVPQMATGGKYAVSWDHFF
TTLGNYYTSMRNDFNTNIGMSGETIYRTRSTPKAITQREAEHLVAVMGIIQAVAEHDEVS
RIMICDHPNWQTPQVLLGLVACATPLFLKAEILHTLAALAKSKETARVIWFHLEASQIIP
TVPVSRSYAQCSLLEEMEQIESRSEQYNLTRGILQLLYTLMTTNLPKSLGAGQRTPAYEG
YLKSMINSVLLKFYNRAYKVPSEKWQVGAQCLKLLYYLLATYRPSAMDFLETVDEPPYPG
FHVMMQLQLKSEMLQLLLCIVEEVRERLDNYNRFQGKKLLEECSLYALLILEAALAKQNA
FFEAHSAANCPILLSGLNRMLLDLNPRSRKPDHVLNIIKYVTYNSWLPRHALAAIKILAS
VTQLPNVSTQILSMYGQGSNEKLEIRQGFVECLEMEVCVGKHDDDLLDQLALNNHVPYLG
FGDDLDNEREMSGEREYSTIESQLELQAGDGALESKPASIELQLKEAIIKLFEMNLSQQL
PNFVYFLLGVDVLREFMANGRQHLAIEMQSSCVNSVVLLLEKYMDKQRHSDKYCEHTARI
VERIYHLFHGLCANRRTAETILRYFRLTCSDFLLRHLRSLPFRQHREDHVLHAMGHLLNC
VSIDVKLAAKHGQMTRFNQMCDILLIGNGMERSSHGLSMELGHSLISQPSSSFLAMDVLP
AGGSISAVAHGAGSASLGAPNTGVKSLKPSLLQETSQGLHVTRLLDILVLEAGTLSQPQL
EFFDGHLITQLLRDCEASAEAGANSRANLINVRKLYYILTDELYMVQSIIASGQRKAIST
EIMLLLNHAVNINRVRTQRCATLAFMAAWGQLVQVLFSNMPDAVLPATQRRQHIIDIVEK
VLIKVQPIQPIIEISVQVSETVLLLLANLRYCCYQAEDQSPEDLAAEDSLSNGNGNAIGN
DSQVNALCLGQRAIGTGSDGGSGGGRDIGSGGNSSNLRFILKNLVQWIMISEVKSQKLRI
NLYSSLLNCLRIAKRLRTDEHLEYQETLISRQESARTYNKEQRRDDRLRLKAMAAEVIGT
FGEKLIDTICHDAVTGHDVCRMLALACLDMISELQAVSTLCDFVASRGYLKHILESLDQS
STALCGILQPVPDHLRPLYVYESRMAFLTRMANSNVGARLLLTEQALGVLSNMKVYDQQP
DLKSSELNRNEPQTFLPSIDDRFRSILLPALSLCDAIVNSLGPRNNSAAVQVLNFLFAHI
DMVEAMLRSATPYMDLGHLQQVAVISNLFARASTHELTALEDSVQLDLRNRLGRVQQLMI
VVFGRFCVSEPTIRRMLQQDEEQQTNPTDDSKRLRVKYFLDIAANVSLYCRNVVTSHSKD
SMTSKYLLTTVINDVTLLTGKMSSKKLTTIMHTILNQLKGSIGYYLSQKSIADNLLQQRA
SLPNISFGPNGKQSYIELSQRYNEKRSELRQAVFIAEQNLYLLWIHLDFYLRNTIDYANE
NRNAINESNMDDDNDMSVLNASQEEIVQLKQLLISTFNETFCTQLINASEDYSIKCKGFN
GSLLRRIKALVQFAPITANDVNSSFDS
NT seq 6204 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtaatcgaggacatgtggacgccgtacaagcatttgtacaacacttttcag
accgcggtgtccaatcgcagtggcttcacctcggatctggagcagtgcctcaagaagtac
aagcacaacttcagcaacttgctgcgcaatccgccgagaagcgagaagagccgcaatctc
ctacgaaatgccctcaacgaaggcgtcccgatgcaggggcattcgcgaaagacaaagatg
tcacaggacctggccgacgaggcggtcattctgtccgacatgttcgatctggacgagggt
ttcgccgtggagctgctgtgcaccgcacagcgccagcagaagcatcatcccggcctgtcc
agaggccttgtcgcggtgctgctctactacgatggacgaaaggccatcagctgcacgctt
cgcgacatgttccaggtggttagcggcgtctcgtggaacaccgaactgcccaaggagatc
accggtctggtcactaactatgccgagagccttgtcgacggctctgggatactgggacgc
ctgctgcagctgctcgaggagatggatgtcgacaaggagtgcgctatgctgaccacaaac
cgcgcgtttggctccaagaagcatcagaaccaggtgctcggcctatacgaggacattcaa
caggcattggcaatggccctgttcaattggtcggcacaacgcggcctgccgcgacacatt
gccattcggctgatgcaccaattggccaaccgaaagaaccacgacgcgggcggcaacatg
gacgacgtgaccctgatcatgctgatggctctgctgtatgcgtacgatacctccatgctg
ctggtcaccgaggaacccaatgagcacacaacccgacttccgatcttcagcgatcgcgag
ttcgccgagtgcttcctggaggagctgtacgcgcagagcagctggcaagcaccgcgcctg
aatgccatcattgcctacagcttcggactaacgctggccagcctgcggcatgcacctttg
cagcttcaggccaccgccatctcgatcatcaatcgcgatgagatgctcatcgacgaggca
ctgggagcgcaggtattcgtcttcttccacagcttgctgctcgagaaggatctggtctat
agcacgcagttcttctaccgccgcgtccatctgctcatcacggacttcatcgacttcatg
aactccaaggtgtcggagctgcgcggccgagcagacgagtcgtcacacacgatcatcagc
ttcctaaacgagggtctggaaccgccgcccaacttggactccaactttgagctgctcatg
ctgtgcgtggccaagatgcacggcgatccgcgcgtcaccatcaggctgtgcaacgagtac
tggggccccggcgatcccaacggctctacggcattcaagaacacctcgcgctcggtgtcg
ctgttcaagttcattagcttggccagcgacctgctgccacagacgctgttcaaggcctac
ctcaagatgatatccggacttacacggaccgatttctcggctcgatgcgccttcaacatg
cttagggtgccccagatggccaccggcggcaagtatgcggttagctgggatcacttcttc
accaccctgggcaactactatacttcgatgcgcaacgactttaacaccaacatcggcatg
agcggcgagaccatttaccgcacccgatcgacaccaaaggccattacgcagcgagaggcg
gagcatctggtggccgtaatgggcatcatacaggcggtggcggaacacgacgaggtctcg
cgcatcatgatctgtgaccatcccaattggcagacgccgcaggtgctcctgggcctggtt
gcgtgcgccacgccgctttttttgaaggcggagattctgcacacgctggctgccctggcc
aaatcgaaggagacggcgcgcgtcatctggttccacctggaggcctcgcagattataccc
actgtgcccgtgtctagaagctatgcccagtgcagtttgttggaggagatggaacaaatc
gagagccgttcggagcagtataacctgacgcgcggcatcctccaattgctctacacactg
atgaccaccaatctgccgaagagtttgggcgccgggcaacggacaccggcctacgaaggc
tatctaaagtccatgataaattcggtgttgctcaagttttacaatcgcgcgtacaaggtt
ccctccgagaagtggcaagttggcgcccagtgcctgaaactgctctactacctactggcc
acctatcggccgtccgcaatggattttctggagacagtcgatgaacctccctatccgggc
tttcacgttatgatgcagctgcagctgaagtccgaaatgttgcagctgctgctgtgcatt
gtggaggaggtgcgtgagcggctggacaactacaatcgctttcagggcaagaagctactc
gaggagtgctcattgtacgcactgctgatcctggaagccgcattggcgaaacagaacgcc
ttctttgaggcccactcggcggccaattgccccattttgctgtcgggcctgaatcgcatg
ctcctggatctgaatccacgcagtcgcaagcccgatcacgtgctgaatatcattaagtat
gtaacctataatagctggctgccgcggcacgccctggccgccattaagattctggcttcg
gtcacccagctgccgaatgtctccacccagattctcagcatgtacggtcagggcagcaat
gagaagctcgagattcgtcagggtttcgtcgagtgcctggaaatggaggtgtgcgtgggc
aagcacgacgacgatttgttggaccaactggccctcaacaatcacgttccgtatctggga
ttcggcgatgatctggacaatgagcgagagatgagcggggaacgcgaatattcaactatt
gaatcgcaactggagctgcaggcgggggatggcgcgctggagagcaaaccggctagcatt
gagctgcaactgaaagaggccattatcaagctgttcgagatgaatcttagccagcagttg
cccaactttgtgtacttcctgctcggcgtggatgtgctgcgcgaatttatggccaacgga
cggcagcacctggccatcgagatgcaaagctcgtgcgtgaactccgtagtgctgttgctg
gaaaagtacatggataaacagcgtcacagcgataagtactgcgagcacacggcgagaatc
gtggagcgcatttaccatctgttccatggactctgcgccaatcgccgcaccgcggagacg
atactgcgctacttccggctaacgtgcagcgacttcctgctgcgtcacctacgctcgctg
cccttccggcagcatcgcgaggatcatgtgctgcacgccatgggccacctgctcaactgc
gtctctatcgatgtcaaactggcggccaaacatggccagatgacgcgcttcaaccagatg
tgcgacattttgctaattggaaacggaatggagcgttcatcccatggcctgtcgatggaa
ttgggccacagcctgatttcacagccgtcgtcgtctttcctcgccatggatgtgctaccg
gccggtggatcgataagtgccgtggcacatggggctggttcggcgtctctcggagctcca
aacactggggtcaaatcacttaagccatcgctgctgcaggagacatcgcagggactgcat
gtcacccgactgctagatattctcgtcctggaggcgggcacgttgagccagccgcagctg
gagttcttcgacgggcatctgatcactcaactgctgcgcgactgcgaggcatccgccgaa
gctggcgccaattccagggccaacttgatcaacgtgcgcaaactgtactacattctcacc
gacgagctgtacatggtgcagagcatcattgccagcggccagcggaaggccatttccacg
gaaatcatgctgctgctcaatcacgccgtcaacataaatcgcgtgcggacacagcgctgc
gccacgctggccttcatggcagcatggggtcaactggtgcaggtgctctttagcaacatg
cccgatgccgtgcttccggcgacgcagcgtcgccagcacatcatcgatatcgtcgagaag
gtactcatcaaggtgcagcccatacagcccatcatcgagatatccgtacaggtgagcgag
acggtgctgctgctgcttgccaatttgcgctactgctgctaccaggccgaggaccagagc
cccgaggatctggccgccgaggattcgctcagcaatggcaatggcaacgccatcggcaac
gattcgcaggtgaacgcattgtgtctgggccagagggcaatcggaactggttcggatggc
ggcagtggaggtggacgggatatcggttccggtggcaacagcagcaatctgcgattcatt
ctcaagaacctcgtccagtggatcatgatcagtgaggtgaagtcgcagaagctgcgcatc
aatctgtacagttcgctgctgaattgcctgcggatcgcgaagcgactgcgcaccgacgag
catctggagtaccaggagacattgatttcgcgccaggagagtgcacgcacgtacaacaag
gagcagcggcgcgacgatcgcctgcggctgaaggccatggcggcggaagtgattggcacg
ttcggcgagaagctgatcgacaccatctgccacgatgcggtgaccggccacgatgtgtgc
cgcatgctggcgctggcctgcctggacatgatctccgagctgcaggcggtgagcacgcta
tgcgactttgtggcatcgcgtggctacctcaagcacatactggaaagccttgatcagtcc
agtacggcgctttgcgggattctgcagcccgtgccggatcacctgaggccgctctacgtc
tacgagtcgcgcatggccttcctcacgcgcatggcgaacagcaatgtgggagcccggctc
ctcctcaccgagcaggcgctgggcgtgctttcgaatatgaaggtctatgaccagcagccc
gacctgaagtccagcgaactgaatcgtaacgagccgcagaccttcctcccgtccatcgat
gaccgcttccggtcgatcctcctgccggcgctgagcctctgcgatgccattgtcaactcg
ctgggtccgcgcaacaactccgccgccgtgcaggtgcttaactttctgttcgcccacatc
gacatggtcgaggccatgttgcgctcggccacgccgtatatggacctcggccacctgcag
caggtggcggtcattagcaatctgtttgcccgcgcctccacgcacgagttgaccgcgctg
gaggatagcgtgcagctggatttgcgaaatcgcctgggccgcgtgcagcagctgatgatc
gtggtgttcggacgcttttgcgtaagcgagcccaccattcgtcgcatgctgcagcaggat
gaggagcagcagaccaaccccaccgatgactcgaagaggctacgtgtcaagtattttctg
gatatagcagccaacgtgtcgctctactgccgcaacgtggtcaccagccattcgaaggac
agcatgacctccaaatacttgctgaccaccgtgatcaatgatgtaacgctgctcactggc
aaaatgtccagcaaaaagctgacgaccatcatgcacaccatcctcaatcagctgaagggc
tccatcggctactacctttcgcagaagtcgatcgccgacaatctcctccagcaacgcgcc
tccctgcccaacatcagctttgggcccaacggtaaacaaagctacatagaactgagccag
cgatacaacgagaagcgcagcgaactgaggcaggccgtcttcattgccgagcagaatctg
tatctgctgtggatccatctggacttctatctgcgcaacaccatcgactacgccaacgaa
aacaggaacgccatcaacgagagcaacatggacgacgacaatgacatgtccgtgctgaac
gcctcgcaggaagagatcgtgcagctcaagcagctgctcatctccacattcaacgagaca
ttctgcacgcagctaatcaacgccagcgaggattactcgattaagtgcaaaggcttcaat
ggctcgctgctgcgacgcattaaggcgctcgtccagttcgcccccatcactgccaacgat
gtcaattccagcttcgattcgtag

DBGET integrated database retrieval system