KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12013Help
Entry
Dmel_CG12013      CDS       T00030                                 

Gene name
PHGPx
Definition
CG12013 gene product from transcript CG12013-RC (EC:1.11.1.7 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dmel_CG12013 (PHGPx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG12013 (PHGPx)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dmel_CG12013 (PHGPx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:63D1-63D1
AA seq 198 aa AA seqDB search
MAGRSIVHFFLGSVAIALGSYIYFTMQIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKY
KGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVC
HLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINR
YAPTTDPMDIAKDIEKLL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctggccgctccatcgtccacttttttctggggtccgtggcaatcgccctgggatcg
tacatctacttcaccatgcaaatcgacatgtctgctaacggagattacaagaacgccgcc
tcgatctacgagttcaccgtgaaggatacccatggcaacgatgtttccctggaaaagtac
aagggcaaggtggtcctggtggtgaacatcgcctccaagtgcggcctgaccaagaacaac
tacgagaagctgacggatctaaaggagaagtacggcgagcgcggcctggtgatcctcaac
ttcccgtgcaatcagtttgggtcccagatgccggaggccgatggagaggccatggtgtgc
cacctgcgcgactccaaggctgacatcggcgaggtgttcgccaaggtcgatgtgaatgga
gacaatgcggcgccgctgtacaaatacctaaaggccaagcagaccggcaccctgggcagc
ggaatcaagtggaacttcaccaagtttctggtgaacaaggagggcgtgcccatcaaccga
tatgccccgaccaccgatcccatggacatcgccaaggacattgaaaagctgctgtag

DBGET integrated database retrieval system