KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12013Help
Entry
Dmel_CG12013      CDS       T00030                                 

Gene name
PHGPx
Definition
(RefSeq) PHGPx, isoform C
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dmel_CG12013 (PHGPx)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG12013 (PHGPx)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dmel_CG12013 (PHGPx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Redoxin PTP2
Motif
Other DBs
NCBI-GeneID: 38413
NCBI-ProteinID: NP_728868
FlyBase: FBgn0035438
UniProt: Q8IRD4
Position
3L
AA seq 198 aa AA seqDB search
MAGRSIVHFFLGSVAIALGSYIYFTMQIDMSANGDYKNAASIYEFTVKDTHGNDVSLEKY
KGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVC
HLRDSKADIGEVFAKVDVNGDNAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGVPINR
YAPTTDPMDIAKDIEKLL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctggccgctccatcgtccacttttttctggggtccgtggcaatcgccctgggatcg
tacatctacttcaccatgcaaatcgacatgtctgctaacggagattacaagaacgccgcc
tcgatctacgagttcaccgtgaaggatacccatggcaacgatgtttccctggaaaagtac
aagggcaaggtggtcctggtggtgaacatcgcctccaagtgcggcctgaccaagaacaac
tacgagaagctgacggatctaaaggagaagtacggcgagcgcggcctggtgatcctcaac
ttcccgtgcaatcagtttgggtcccagatgccggaggccgatggagaggccatggtgtgc
cacctgcgcgactccaaggctgacatcggcgaggtgttcgccaaggtcgatgtgaatgga
gacaatgcggcgccgctgtacaaatacctaaaggccaagcagaccggcaccctgggcagc
ggaatcaagtggaacttcaccaagtttctggtgaacaaggagggcgtgcccatcaaccga
tatgccccgaccaccgatcccatggacatcgccaaggacattgaaaagctgctgtag

DBGET integrated database retrieval system