KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12068Help
Entry
Dmel_CG12068      CDS       T00030                                 

Gene name
sro
Definition
shroud (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dmel_CG12068 (sro)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dmel_CG12068 (sro)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Dmel_CG12068 (sro)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99C1-99C1; 3R:3-100 cM
AA seq 335 aa AA seqDB search
MSGSQLLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHN
IKSEGAKLLQGLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINN
AGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPA
LGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSA
EQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESLLAKFKDALTSSQPLALYIEEPRRYRL
YRWLFTLCPTPLVDWLTVRFCAMPTYESTNRQEKI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcagtcaacttcttcgcgccctgcgacgatccctgggattgggcaggcagcag
ctgaaggtcgatagccggcatgtggtgctcatcacgggctgcgattcgggattgggccac
tccatggcagtttactgccacgaatcgctgcacatgaccgtgatttcctgctgccacaac
atcaagtcggaaggagctaaactgctgcagggcctagcctcggccaaggatggactgagc
agaatgcacaccttggaactggatctattggaacccgattccattcgcctggtgcatcgc
cagctaagggacatactggccaaagaccccagctatcggctgacggcactgataaacaat
gctggagtaatgtgcttcggggaattcgagtggcagctaacggagcagatcgaggcgcag
atcaactgcaacctgctgggcaccatgaggctgacacatgaactgctgcccctgctccgg
cagcagcagggcaggatcatcaatgtgaccagccactgcggattgcaggctctgccggca
ctgggtccttatgccgcctccaaggcagcccttcgcttctggacggattcactccgcgtg
gagctgcagcagtatggcatggaggtggtcaacttcataccaggctccttcgtcctggac
agcaacattgcggccagacagcagcagcatgctcagaagatgcgcgaagccttcagtgcg
gagcaacacgctctgtacgacacttacttcgaggccttcaatggttatctgaaagtactg
agcggcttcaagccgcccaatcgcctgaggaacgagtcgctgctggcaaagtttaaggat
gcattgaccagctcacaacccttggctctgtacatcgaggaaccccgtagatatcgcctc
tatcgctggctctttacgctctgccccactccgctagtggattggctcacggtgcgtttc
tgcgcgatgcccacctacgagtcaacgaacaggcaggagaagatttag

DBGET integrated database retrieval system