KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12082Help
Entry
Dmel_CG12082      CDS       T00030                                 

Definition
CG12082 gene product from transcript CG12082-RB (EC:3.1.2.15 3.4.19.-)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG12082
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG12082
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG12082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:63B6-63B7
AA seq 827 aa AA seqDB search
MEELRKHLSKVNVPCASGAGSPPIYKDECVYSYDNPETPTGLYVCLHSFLGFGEAYVREY
ADKTGNRVFLHIQRVKTIKEGADMEAECAESEAGPERKITRLAIGVEGGYNESDMAKKYE
IKDTYSIVVAPHLDKKLPYPDPELPMRVTQSVEAILAADSAIAKLEKATLMGTWDGEVRQ
ASKYADNLQQLDNGKRIPPSGWQCEKCDLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAVE
HYRVTGFPLAVKLGTITADGKSDVFSYPEDEMVLDPHLERHLSHFGINMAAMKKSEKSMV
ELELDINQRIGEWTALTESESELQPVAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQQRF
VGTGAERYFKEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHSTGISPAMFKNI
VGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQTNPADALKFLLEDRVECLASHKVKYN
TREEYSFRLPVPLDKATNLDEVREFQERKKAARETGQRLPDRDIVRHKVPLQACLERFFG
PELIEQFYSTAIGSKTNARKITRLATMPDCLMIHVGKFTLGDDWVPKKLDVSVDMPDELD
LSNWRSAGGLQPGEEALPEPATEEVKFAFDEAVMSELLTMGFPPEACKRACYHTKNSGLE
AASNWLMEHIADEDISEPFVVPNNSIGDCAANQFVANPESLAMLMSMGFDERQAVAALKA
TDGNVERATDWIFSHADSIGVEDAAPAANSSAAAASSTPNKTNYRDGRGKYRLVAFISHM
GTSAQVGHYVCHIRKKGEWVIFNDSKVAKSQNPPKDLGYLYLYMREQ
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggaggaactacgcaagcatttatccaaggtgaacgtgccatgcgcatccggggcgggc
agtcctcccatctacaaggacgagtgcgtctactcctatgacaatcccgagacgcccacc
ggtttgtacgtgtgcctgcacagctttttgggcttcggcgaggcgtatgtgcgggagtat
gccgacaagaccggcaaccgggtcttcctccacatccagcgggtgaagacgatcaaggag
ggcgccgacatggaggccgaatgcgcggagtcggaggcaggaccggaacggaagatcacc
cgcctggccattggcgtcgagggcggctacaacgagtcggacatggccaagaagtacgag
atcaaggacacgtacagcatcgtggtggctccgcacctggataagaagctgccctatccg
gatccagagctgcccatgcgtgtcacccagtcggtggaagcgatcctggccgccgactcg
gcaattgccaagttggagaaggccacgctgatgggcacctgggatggtgaagtgcgtcag
gcgtcgaagtacgcagataacctgcagcagctggataatggcaagaggattcccccatcc
ggctggcagtgcgagaagtgcgacttgaccaacaacctctggcttaatctgaccgatggt
tcgatcatgtgcggacgcaagttctttgacggcagtggcggcaacgatcacgccgtggag
cactacagagtaacgggtttcccgctggcggtgaaactgggcaccatcaccgctgatggc
aagtcggatgtgttctcctacccggaggatgaaatggtactcgatccacacttagagcgc
catctctcccactttggcatcaacatggcggcgatgaagaagagcgagaagtcgatggtg
gagctagagttggacattaaccagcgcatcggcgagtggacggcgcttacggagagcgaa
agtgagctgcagcctgttgctggtcctggatacactggcatgcgcaatctgggcaactcc
tgctacataaacagcgtgatgcaagtgctcttcgtcatcccagacttccagcagcggttc
gtgggcactggagcggaacgctatttcaaagagtttcccagcgacccggccaacgacttc
aatattcaaatggccaagctgggaactggtctgcagtcgggaaagtacagcagtattgcc
gagaacactttggacaccgatcacagcaccggaatatcgccggccatgtttaagaacatt
gtgggcaagaatcacccagatttcagcaccaaacagcagcaagatgccaacgatttctat
ctgcatttgctcaccctgctggacaggaattcgcggaaccaaacaaatcccgcagatgct
ctaaagttcctgctggaggatcgcgttgagtgtctggccagccacaaggtgaagtacaat
acccgcgaggaatacagcttccgtctgcctgttccgttggacaaggccaccaatctggat
gaggtgcgggagttccaggagcgtaagaaggcggcccgcgagaccggacaacggcttccg
gatcgcgacatcgtgaggcacaaggtgcctctacaggcatgcctggaaaggtttttcggc
ccggagctgatcgagcaattctactccactgccatcgggtccaagacgaatgccaggaaa
attacgcgattggccaccatgcccgactgcctgatgattcacgtgggaaagttcacgctg
ggcgacgactgggtgcccaagaaactggacgtttccgtagacatgcccgatgaactggat
ctaagtaactggcgctccgctggtggcttgcagcctggtgaggaggctcttcccgagccc
gccacagaggaggtgaagtttgcatttgacgaggcggtcatgtccgagttgctgaccatg
ggttttccaccggaagcctgcaagcgtgcttgctatcacaccaaaaacagcggacttgag
gcagcctccaactggttgatggagcacatcgccgacgaggatatctcggagccctttgtg
gtgccgaacaacagcattggagactgcgccgccaaccagtttgtggccaatcccgagagc
ctggccatgctcatgagcatgggcttcgacgaaagacaggcggtggctgctctgaaagcg
accgatggcaatgtggagcgcgccaccgactggatcttctcgcacgccgattcaattggt
gttgaggatgctgcccccgctgcgaattcatcagctgcagcggcctcctcgacgccaaat
aagaccaactaccgcgatggccgcggcaagtatcgcctggtggcattcatctcacacatg
ggcacctccgcccaggtgggacactacgtttgtcacattcgcaagaagggcgaatgggtg
atcttcaacgatagcaaggtggccaagtcgcagaacccacccaaggacctcggctatctg
tatctgtatatgcgcgaacagtag

DBGET integrated database retrieval system