KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12131Help
Entry
Dmel_CG12131      CDS       T00030                                 

Gene name
Adam
Definition
(RefSeq) adam, isoform B
  KO
K03245  translation initiation factor 3 subunit J
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG12131 (Adam)
Ribosome biogenesis [BR:dme03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    Dmel_CG12131 (Adam)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dmel_CG12131 (Adam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit alpha-hel2 PBP1_TM GCHY-1 TraF
Motif
Other DBs
NCBI-GeneID: 36037
NCBI-ProteinID: NP_001286260
FlyBase: FBgn0027619
UniProt: Q7K550 A0A0B4LF26
Position
2R
AA seq 236 aa AA seqDB search
MADDWESAADSEVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQALLEEEAEAKRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEILHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgaggtggtcatccggccgactgccgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gatgaggaggaaaaaaaggacgaggagaagcctacgaaaacagaagcaccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgctcctagaggaggaagcg
gaggcaaaacgtttggccaacctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgcccaggaagcgttcggtgtgacgagt
acgtgcggaggtcttgacgccttcaaccccgagaccaaggaggagttcaaggaatttggc
gcaacgctcagctggaaggtgggccaattccgcgagtcggagcacttcccccaatttgtt
gaggatctggtgcgcagcctatgcgtgaatctgagcgctgctgacatcaaaaaggtcaag
atgaacgtggaaatcttgcactcggaaaagctgaagctggaaaaggccaatgctaaaaag
cccgctggaaagggcaagggcaaggtcactctccgcaccgaaaacgacgacattgacggt
taccaaaagtacggaaatgacttcaccgaagactatgacgacttcatgtga

DBGET integrated database retrieval system