KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12131Help
Entry
Dmel_CG12131      CDS       T00030                                 

Gene name
Adam
Definition
CG12131 gene product from transcript CG12131-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG12131 (Adam)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dmel_CG12131 (Adam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:46C8-46C9
AA seq 236 aa AA seqDB search
MADDWESAADSEVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQALLEEEAEAKRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEILHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgaggtggtcatccggccgactgccgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gatgaggaggaaaaaaaggacgaggagaagcctacgaaaacagaagcaccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgctcctagaggaggaagcg
gaggcaaaacgtttggccaacctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgcccaggaagcgttcggtgtgacgagt
acgtgcggaggtcttgacgccttcaaccccgagaccaaggaggagttcaaggaatttggc
gcaacgctcagctggaaggtgggccaattccgcgagtcggagcacttcccccaatttgtt
gaggatctggtgcgcagcctatgcgtgaatctgagcgctgctgacatcaaaaaggtcaag
atgaacgtggaaatcttgcactcggaaaagctgaagctggaaaaggccaatgctaaaaag
cccgctggaaagggcaagggcaaggtcactctccgcaccgaaaacgacgacattgacggt
taccaaaagtacggaaatgacttcaccgaagactatgacgacttcatgtga

DBGET integrated database retrieval system