KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1216Help
Entry
Dmel_CG1216       CDS       T00030                                 

Gene name
mri
Definition
mrityu (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dmel_CG1216 (mri)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dmel_CG1216 (mri)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG1216 (mri)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61B2-61B2
AA seq 439 aa AA seqDB search
MSNTPSLNSSSSNISSKAPLAQKQDTYSSDSSEEVLETAEERRRRILKERSRLNRPQHNM
SGGGAVPKHDIKSPCGASPSCQATGSGMGRLPLPPERITMLVDGVRFTVEQSLLTAHPTT
MLGTMFGSGFQFAHTNERGEYDVADGISHLVFRAILEYYKSGVIRCPPTVSVPELKEACD
YLLIPFDATTVRCQNLRGLLHELSNEGARQQFELFLEDLILPLMVASAQRGDRECHVVVL
LEDDMVEWDEEFPPQMGEEYCQTVHSTAMHRFFKYIENRDVAKQVMKDRGLKKIRCGIEG
YPTHKEKIRRRPGGRAEVIYSYVQRPFIHMSWEKEEAKSRHVDFQCVKSKSVTNLAEANA
DPPLELDASGNPIPPIAVANPHPNNAELAAGMAVAPAAIGVAGPAVVVAVDEAAGGVVML
NELDQAAIAVAVGIVDENM
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacactccaagtctgaacagtagtagtagcaatatcagtagcaaggcgcccctt
gcccagaagcaggacacgtacagtagcgacagcagcgaggaagttctcgaaacagccgag
gagcggaggaggcgcatcctgaaggagcgcagccggctgaaccgtccgcagcacaatatg
tcaggcggaggtgctgtgcccaagcacgacataaaatccccttgcggagcatctcccagc
tgccaggcaactggttccggaatgggccgcctgccgctccctcccgaaaggatcaccatg
ctggtggacggtgtgcgcttcacggtggagcaatcactgcttacagcacatcccaccaca
atgcttggcacgatgttcggctccggcttccagttcgctcataccaacgagcgcggcgag
tacgacgttgccgacggcatttcgcacttagtgttcagagccattctggagtactacaaa
agcggtgttatccgctgcccgcccactgtttcggtaccggaactaaaagaagcctgtgat
tatctgctcattcccttcgacgcaaccacggtgcgctgccagaacctaagaggccttctc
cacgagcttagcaacgaaggagcgcgacaacaatttgaactctttcttgaggacctaatt
ctgcccctcatggtggcctcggcgcagcgcggggatcgagagtgtcacgttgtggtgctc
cttgaagacgatatggtcgagtgggatgaagagtttccgcctcagatgggcgaggagtat
tgtcagaccgtgcacagcactgccatgcaccgattcttcaagtacatcgagaaccgcgat
gtggccaaacaggtgatgaaggatcgcggtctgaagaagatacgctgtggcatagaggga
taccccacccacaaagagaagatccgaaggcgtcccggtggacgggctgaagtcatctac
agctatgtgcagcgacctttcatccacatgtcctgggagaaggaggaagcaaagagtcgc
catgttgatttccaatgtgtaaaatccaagtctgtaacgaatctagcggaagcaaatgca
gatccgccactggaattggacgcaagtggaaatccgattccccctatagcagtggctaat
ccgcatcccaataacgctgagctcgctgccggtatggccgtcgcacccgcagctataggc
gtggctggtccagcagtcgtggtagccgtcgacgaggcggccgggggcgttgtaatgctc
aacgagttggaccaggcagcgatcgctgttgccgtcggaatagttgatgaaaatatgtag

DBGET integrated database retrieval system