KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12182Help
Entry
Dmel_CG12182      CDS       T00030                                 

Definition
CG12182 gene product from transcript CG12182-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG12182
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dmel_CG12182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:62E7-62E7
AA seq 627 aa AA seqDB search
MVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIYDSCDVLEAQHLALDPAYTAVCSVA
VPPARLTAVKRAPKLAANGNLLLGSLNTYGSLSLINKSAEYNRWNPVEGLNIAETLRDTL
LPEVDIAKIKDFKSYQEYINPAWITMFAWLPDDADATGQHVLVLGTAAGSLWLLTLSADV
KTLLSHQETKTSMGRICHIQAFKDLLLVGDSNGLIHLYQLPAKGNTALALVKPLWEKADR
MGLQMAVITECPRMDCYYITCCKAAHLLTWSMPRTGSTDCLQARIYVGGMKITALCSLEN
SSYVAGTAGSCLSCVQIIHENNQLSLQMQSIAMGVLQDFQVMGLCTSRHKNLMTLLLYRN
KEYLNETVSQKNQLVMQVLKVGNQDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENW
QKFMDFCPLDSIEFADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLL
LAMLNITHIRLRLQFIGSLSKRSPFQEQAIKCMFEEAHRLINKLNDDFTENHALGSTART
FVEQMGNHIQHLHEMLGIPVISNPQKQLHRCSVSFVEISLSLERRYCSLCNRQILFELDN
LQELYESGRHLTCPVCHGSFATEMFNA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtggatccctttccgtattttgtggccatttatgattccaacgctgcggaaaca
cgacctctggacgttttggccaacaaagtggatctggttgccatatacgacagctgcgat
gtcctggaggcacagcacttggccctggacccggcatacacggctgtgtgctccgttgcc
gtgccaccagccagactaacagctgttaagcgagcacccaagctggcagctaatggaaat
ctcctcctgggctccctcaacacttatggatccttgagcctaataaacaagtccgctgag
tacaatcgttggaaccctgtggaaggactaaatatcgctgaaactctgagggacactctg
ctgcctgaagtggacatcgccaagataaaagactttaagagctatcaagaatatattaat
cccgcctggatcactatgtttgcttggttacctgatgatgcagatgccactggccagcat
gttttggttctgggaacagccgcaggaagtttgtggttgctcacactaagcgccgatgtc
aaaactcttttaagtcatcaagaaacgaaaacctcaatgggtcgtatctgccatatacaa
gctttcaaggaccttctactggtgggcgatagcaacggactcattcacctgtaccaattg
ccagctaagggaaatacagctctcgccttagtgaagcccttgtgggagaaagccgatcgc
atgggtctgcaaatggcagtgatcactgaatgtcccagaatggattgctattatataacc
tgctgcaaggcggcgcacctgctgacctggagcatgccaagaacggggagcacagactgc
ctgcaagctcggatctatgtcggcggaatgaagatcaccgctctctgcagcctggagaac
agtagctacgttgcaggaaccgctggaagctgtttgtcttgcgtacaaattatccacgag
aataatcagcttagcctgcagatgcaatcgatagccatgggtgtccttcaggatttccag
gtgatgggactgtgcaccagtaggcacaagaacttaatgaccctgttactctaccgcaac
aaggaatatctaaatgaaactgtatctcaaaagaaccagttggttatgcaagtgctcaag
gtggggaatcaggatccacttgatcagcttgtcaggcatctggaatccaataagcccatg
aatcactataccgatttattagctggactacgtctgcacgtttttgccgaggagaattgg
caaaaatttatggacttttgtccattagattccattgaatttgccgataccgccactgaa
ggtcagctgcagcagctgcaaattaaatttcatgttcttcaaaacgtgattcgcctgcaa
tcgagccacctccagctgacagttcacatccaaaagtcccgggatgaactgcagctgctc
cttgcgatgctgaatatcacacacataagactgaggctccagtttattgggtcattaagt
aagagatcaccattccaggagcaggcgataaaatgtatgttcgaggaggcccacagactg
ataaataaactcaatgacgacttcacggaaaaccatgccctaggatccacagcaaggaca
ttcgttgaacaaatgggcaaccatattcagcacttgcacgagatgctaggtatacctgtg
atatctaatccccagaagcaacttcatcgatgcagtgtgtcctttgtggagatctccctc
agcttggagcgacgctactgcagcctctgcaaccgccaaatcctattcgagctggacaat
ctgcaagaactctacgagtcggggagacatctgacatgtcccgtttgccatggaagcttt
gccacggaaatgtttaatgcataa

DBGET integrated database retrieval system