KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12244Help
Entry
Dmel_CG12244      CDS       T00030                                 

Gene name
lic
Definition
licorne (EC:2.7.11.- 2.7.11.13)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Module
MAPK (p38) signaling
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG12244 (lic)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmel_CG12244 (lic)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11D10-11D10
AA seq 334 aa AA seqDB search
MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIV
DKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGM
IEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDAQPAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgccaccgcctcacgccctttaccattgccaaggagccagaggccgccata
gtcccgccacgcaacctggactcgcgggccaccatccaaattggcgaccggacctttgac
atcgatgcagatagtctcgagaagatctgcgatctgggccgtggcgcctatggcatcgtg
gataagatgcgccataagcaaaccgatacggtcctggccgtcaaacgcatacccatgacc
gtaaatattcgagaacagcaccgccttgtaatggatttggacatatcgatgagatccagc
gactgcccctacaccgtccacttttatggtgcgatgtatcgcgagggcgatgtctggatt
tgcatggaggtgatgagcaccagcctggacaagttctatccgaaggtcttccttcacgat
ctgcgaatggaggaaagcgtgctgggcaagattgccatgagcgtggtcagtgcgctgcac
tatctgcacgctcaactgaaagtcattcatcgggacgtcaagccctcgaacatactgatc
aatcgggccggccaggtcaagatctgtgactttggcatctcaggctacctcgtcgactcc
attgccaaaaccattgatgccggttgcaagccgtacatggcgccggaacggatcgatccc
caaggaaatccggcgcaatacgacatcaggtcggatgtttggtcgctgggcatcggcatg
atcgaaatggccacgggccgctacccatacgacaattggcgaacgccatttgagcaactg
cgtcaggtggttgaggacagtccgccgcgcctgccggagggaacattttcgccggaattc
gaggacttcatcgccgtctgcctgcagaaggagtatatggcaaggcccaactacgagcag
ctgctcaagcacagcttcatcgtggagcacctgcagcgcaacacggacatctcggagttc
gtggccaggatactggatctgcccgacgcgcagccggcgcagtag

DBGET integrated database retrieval system