KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12284Help
Entry
Dmel_CG12284      CDS       T00030                                 

Gene name
Diap1
Definition
(RefSeq) Death-associated inhibitor of apoptosis 1
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG12284 (Diap1)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    Dmel_CG12284 (Diap1)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    Dmel_CG12284 (Diap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3L:72C1-72D1; 3L:3-43.2 cM
AA seq 438 aa AA seqDB search
MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLD
KRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPI
NAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTA
APQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNL
KQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQL
YIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAAT
RIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVT
KCPLCRKPFTDVMRVYFS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgttgtagctgatcttccgtcttatggacctatcgcttttgatcaggtggat
aacaacacgaacgcgacccagctattcaaaaataatataaacaaaaccagaatgaacgat
ttaaaccgcgaggagacgcgattaaagaccttcaccgactggccgctggactggctggat
aaacgccaattggcccaaaccggcatgtacttcacacacgccggcgacaaagttaaatgc
tttttctgcggcgtggaaatcggttgctgggagcaggaggatcagcccgtgccggaacat
cagcgatggtcgcccaactgtccactgttgcgccggcgcactaccaacaatgtgccgatc
aatgccgaagcattagatcgcatcctgccgccaataagctacgatatctgcggcgccaac
gactcgacgctggagatgagggagcatgcctacgcagaaggcgtcatacccatgtcgcag
ctaattcagtcgattggcatgaatgcagtaaatgcggcaggcagtgtaactggaaccgca
gccccgcagccgagggtaacggtcgccacccatgcgtcgacggcgacacaggccactggc
gatgtccagccggagacgtgtcgtccttcagccgccagtggcaattattttccccagtat
cccgaatacgccatcgagacggcacgcctgcgcaccttcgaggcttggccgaggaacctg
aaacagaagccccaccagctggccgaggcgggtttcttctatacaggcgttggggatcgc
gtccgctgcttcagttgcggcggtggtctcatggattggaacgacaacgacgagccctgg
gaacagcacgctctctggctaagtcagtgccgattcgtcaagctgatgaagggtcagctc
tatatcgatacggtggccgccaaaccagtgctggccgaggagaaggaggagagctcttcg
attggaggggtcgcggtggccagcacacaggcttcagaggaagagcagcagacatcactc
tcatcggaggaggccgtttcgggggatgtggctccgtccgtagctcccacggcagccaca
cgcatcttcaacaagatcgtcgaggcgacagcggtggctactccctcgacaaacagcagc
ggctccacctccatacccgaggaaaagttgtgcaagatctgctacggcgccgagtacaat
acggcattcctgccatgcggtcatgtggtggcctgcgccaagtgcgcctcctctgtgaca
aagtgtccgctgtgccggaagcccttcaccgatgtgatgcgcgtatatttttcttaa

DBGET integrated database retrieval system