KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12284Help
Entry
Dmel_CG12284      CDS       T00030                                 

Gene name
th
Definition
thread (EC:6.3.2.19)
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG12284 (th)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    Dmel_CG12284 (th)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3L:72C1-72D1; 3L:3-43.2 cM
AA seq 438 aa AA seqDB search
MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLD
KRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPI
NAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTA
APQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNL
KQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQL
YIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAAT
RIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVT
KCPLCRKPFTDVMRVYFS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgttgtagctgatcttccgtcttatggacctatcgcttttgatcaggtggat
aacaacacgaacgcgacccagctattcaaaaataatataaacaaaaccagaatgaacgat
ttaaaccgcgaggagacgcgattaaagaccttcaccgactggccgctggactggctggat
aaacgccaattggcccaaaccggcatgtacttcacacacgccggcgacaaagttaaatgc
tttttctgcggcgtggaaatcggttgctgggagcaggaggatcagcccgtgccggaacat
cagcgatggtcgcccaactgtccactgttgcgccggcgcactaccaacaatgtgccgatc
aatgccgaagcattagatcgcatcctgccgccaataagctacgatatctgcggcgccaac
gactcgacgctggagatgagggagcatgcctacgcagaaggcgtcatacccatgtcgcag
ctaattcagtcgattggcatgaatgcagtaaatgcggcaggcagtgtaactggaaccgca
gccccgcagccgagggtaacggtcgccacccatgcgtcgacggcgacacaggccactggc
gatgtccagccggagacgtgtcgtccttcagccgccagtggcaattattttccccagtat
cccgaatacgccatcgagacggcacgcctgcgcaccttcgaggcttggccgaggaacctg
aaacagaagccccaccagctggccgaggcgggtttcttctatacaggcgttggggatcgc
gtccgctgcttcagttgcggcggtggtctcatggattggaacgacaacgacgagccctgg
gaacagcacgctctctggctaagtcagtgccgattcgtcaagctgatgaagggtcagctc
tatatcgatacggtggccgccaaaccagtgctggccgaggagaaggaggagagctcttcg
attggaggggtcgcggtggccagcacacaggcttcagaggaagagcagcagacatcactc
tcatcggaggaggccgtttcgggggatgtggctccgtccgtagctcccacggcagccaca
cgcatcttcaacaagatcgtcgaggcgacagcggtggctactccctcgacaaacagcagc
ggctccacctccatacccgaggaaaagttgtgcaagatctgctacggcgccgagtacaat
acggcattcctgccatgcggtcatgtggtggcctgcgccaagtgcgcctcctctgtgaca
aagtgtccgctgtgccggaagcccttcaccgatgtgatgcgcgtatatttttcttaa

DBGET integrated database retrieval system