KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12311Help
Entry
Dmel_CG12311      CDS       T00030                                 

Gene name
tw
Definition
(RefSeq) twisted, isoform B
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00514  Other types of O-glycan biosynthesis
dme00515  Mannose type O-glycan biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    Dmel_CG12311 (tw)
   00514 Other types of O-glycan biosynthesis
    Dmel_CG12311 (tw)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dmel_CG12311 (tw)
Glycosyltransferases [BR:dme01003]
 O-Glycan biosynthesis
  O-linked Man type
   Dmel_CG12311 (tw)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR WBP-1
Motif
Other DBs
NCBI-GeneID: 31024
NCBI-ProteinID: NP_001259102
FlyBase: FBgn0086368
UniProt: Q9W5D4 M9PG53
Position
X
AA seq 765 aa AA seqDB search
MAASVVKTPKCPRRGSVKDVAQNAPRTAPTSSKEANWNWWLLLATVFLVTFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNE
TRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLAAAYLIFDVGLLTLNQYILLDPI
LLFFMMASVWGMVKVSKSTASGGSYGLRWWLWLFLTGTMLSCTISVKFVGLFVVLLVGLH
TATELWLILGDLGQPILETVKQLACRAITLIVWPVLLYILFFYIHLSVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSLVTIKNHKTGGGYLHSHHHLYPKGSGARQQQVTTY
THKDENNKWLIRPHNKPGPPKGKVQILRHGDLVRLTHMATRRNLHSHNEPAPMTKKHLQV
TGYGELGLGDANDVWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQLPKWGFEQ
QEVSCNPNVRDKNSQWNVEDNEHKLMPSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVTVFLCNAVVQQRRA
GFARSAAQNQAQVPDSETVAQDEESEHSTTDICSCCTPAKEIVPKAVPSGSPEAPNPAQS
LRAAAWLFLGWMLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMYNYILRVLPKWIHHVI
LGLVLSILVYSFAAFSPLAYGMSGPLANEPNSTMYNLKWLSTWEF
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaagtgttgttaaaacccccaagtgccccagacgaggatctgtcaaagatgtg
gcccaaaacgcacctagaacagcacccacatctagcaaagaggccaattggaactggtgg
cttctcctggctaccgtcttcctggtgaccttcgccacccgcttctataaggtcaccgag
ccggatcacatatgttgggatgagacgcactttggcaagatgggcagttggtacattaac
agaaccttttttttcgatgtccatccaccgctaggaaagatgctcattggcctctctggc
tacttgacgggctacaatggaacgtttccgtttgagaagccaggtgacaagtacaacgag
acgcggtaccagggcatgcgatatttctgcaccacactgggagctctgatcatgcccatg
ggattcgatactgtctacgatttgacccgttcccatgaagctgccttgcttgcggctgcc
tatcttattttcgatgtggggctcttgaccctgaaccagtacatcctgctggaccccatt
ctgttattcttcatgatggcctccgtctggggcatggtcaaggtatcgaagtccacggcc
tccggaggatcgtacggtctacgctggtggctctggctcttcctcaccggcaccatgttg
tcctgcacgattagcgttaagttcgtgggtctgtttgtggtgctgctggtcggtctgcat
acagccactgaactgtggctcatcctcggcgatttggggcagcccattttggagactgtt
aagcagttggcctgccgggccatcaccctgattgtctggcccgttctcctctacatcctg
ttcttctacattcacctgagtgtccttaaccgcagcggcaacggagatgggttctatagt
tcggcctttcagtccaggctgatcggcaactccctatataatgccagcatgcccagagat
gtcgcctacggatcgctagtgacaatcaagaaccacaagacgggcggaggctacctgcac
tcgcatcatcacctgtatcccaagggatctggcgctaggcagcagcaggttaccacttac
acccacaaggacgagaacaacaagtggctaatcaggccgcacaacaagccgggtccacca
aagggcaaggtacagatcctccggcacggggacctcgtccgcctgactcacatggcgacc
aggagaaatctgcattcccacaacgaacctgcacccatgaccaagaagcatttgcaggtc
acaggctatggcgagttgggactaggcgatgccaacgacgtctggcgcgtgttgattgtg
ggcggcaaggtcaacgaaacggtacacacggtcacttcccgtctcaagttcatccacctg
ctgcagaactgcgccctgacctccagtgggaagcagctaccgaaatgggggttcgaacag
caggaggtgtcatgcaatcccaacgtgcgcgacaagaactcgcagtggaacgtcgaggac
aacgagcacaagttgatgcccagtgtaagctttagcgtgtatgcgcccggcttctttgcc
cgcttcctcgaatcccacgccgtaatgctgcagggaaacgcaggactcaagcccaaagaa
ggcgaggtcaccagcagaccctggcagtggccaatcaactacaggggccagttcttctcc
ggcagcagttaccgcatctacttgctgggaaacccgttgatttggtggagtaatctggtt
ttcctggcccttttcgtcacggttttcctgtgcaacgcagttgttcagcaaagaagagct
ggcttcgcccgatcggcggcccaaaatcaagcccaagttcccgattcggaaacagtggcc
caggacgaggagagtgagcactccaccacggacatctgcagttgttgtactccggcgaag
gagatagtcccaaaggcagttcccagtgggtccccggaggcacccaacccggcgcagtcc
ttaagggcggccgcctggctttttctgggctggatgctccactatttgcccttctgggcg
atgggacgggtgctctacttccaccactattttccggccttgatcttcaactccttgctg
acgggcgttatgtacaactacattttgagggttctgcccaaatggattcaccacgttatc
ctcggactggttctctcgatcctggtgtatagttttgccgccttctcgccacttgcttac
ggaatgagtggtcctctagccaacgagccgaactctacaatgtacaatctcaagtggctt
tctacctgggagttctag

DBGET integrated database retrieval system