KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12385Help
Entry
Dmel_CG12385      CDS       T00030                                 

Gene name
thetaTry
Definition
thetaTrypsin (EC:3.4.21.-)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmel_CG12385 (thetaTry)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dmel_CG12385 (thetaTry)
Peptidases [BR:dme01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dmel_CG12385 (thetaTry)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG12385 (thetaTry)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:47F3-47F4
AA seq 262 aa AA seqDB search
MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHF
CGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEY
DVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNI
VDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNL
LPGVYSDVPALRKWILNASETL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcacagattagtggttcttttagtttgcctggctgtgggttccgcctgtgctggcaca
gtcggggtctccaatggtgatcccttcgagcgcgaaggtcgcattgtcggcggcgaggat
acaacaatcggagcgcatccctaccaggtttccctgcagaccaagagtggctcccacttc
tgtggtggtagtttgatcaacgaagatactgttgtcacggcggcccactgtctggtggga
aggaaggtctccaaggtgttcgtgcgtctcggttccacgctctacaatgagggtggaatt
gtggttgctgtccgggagttggcatacaatgaggactataactcgaagaccatggagtac
gacgtgggcatactgaagctggacgagaaggtaaaggaaaccgaaaatattcgatatatc
gaactggccacggaaacgccgcccactggcaccaccgctgtggtcaccggctggggttcc
aagtgctacttctggtgcatgacactgcccaagacgctccaggaggtctatgtcaacatt
gtggactggaagacgtgcgcttcggatgagtacaagtacggagagatcatctacgatagc
atggtgtgtgcctatgaaaagaagaaggacgcttgccaaggagattccggtggtcctctg
gcggtcggtaacactctggtgggaatcgtgtcctggggatatgcctgtgcctcgaaccta
ctgcccggtgtttactccgatgtgcccgctttgcgaaagtggatcctgaatgcaagcgaa
actttgtag

DBGET integrated database retrieval system