KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12385Help
Entry
Dmel_CG12385      CDS       T00030                                 

Gene name
thetaTry
Definition
thetaTrypsin (EC:3.4.21.-)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dme04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:47F3-47F4
AA seq 262 aa AA seqDB search
MHRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHF
CGGSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEY
DVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNI
VDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNL
LPGVYSDVPALRKWILNASETL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcacagattagtggttcttttagtttgcctggctgtgggttccgcctgtgctggcaca
gtcggggtctccaatggtgatcccttcgagcgcgaaggtcgcattgtcggcggcgaggat
acaacaatcggagcgcatccctaccaggtttccctgcagaccaagagtggctcccacttc
tgtggtggtagtttgatcaacgaagatactgttgtcacggcggcccactgtctggtggga
aggaaggtctccaaggtgttcgtgcgtctcggttccacgctctacaatgagggtggaatt
gtggttgctgtccgggagttggcatacaatgaggactataactcgaagaccatggagtac
gacgtgggcatactgaagctggacgagaaggtaaaggaaaccgaaaatattcgatatatc
gaactggccacggaaacgccgcccactggcaccaccgctgtggtcaccggctggggttcc
aagtgctacttctggtgcatgacactgcccaagacgctccaggaggtctatgtcaacatt
gtggactggaagacgtgcgcttcggatgagtacaagtacggagagatcatctacgatagc
atggtgtgtgcctatgaaaagaagaaggacgcttgccaaggagattccggtggtcctctg
gcggtcggtaacactctggtgggaatcgtgtcctggggatatgcctgtgcctcgaaccta
ctgcccggtgtttactccgatgtgcccgctttgcgaaagtggatcctgaatgcaagcgaa
actttgtag

DBGET integrated database retrieval system