KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12582Help
Entry
Dmel_CG12582      CDS       T00030                                 

Definition
CG12582 gene product from transcript CG12582-RG (EC:3.2.1.25)
Orthology
K01192  
beta-mannosidase [EC:3.2.1.25]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Lysosome
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dme00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dme04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:81F6-81F6
AA seq 908 aa AA seqDB search
MKYGCGLLRNGTTGAVMVGLVCGLYVCSGQCDKVEVIELSNWTITNQNGSLTIANQTLPL
GIYSAFAPQVLDSYNDVGLRYLAYDNFTFSNFFQFDVHHFNRGHINLTFHGIDTVSEIRL
NHQLLGRTDNMFVRYSYEVSSLLQAENFLEVEIQSPVVAALARANALKEAKKSVPPECPN
ERYHGECHMNMLRKMQASFSWDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSY
WNMHIRCFLDAGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGK
VVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLDLVEDPAPDGV
GNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQISHLLRSAKEAHMNMLRVWGGGVYES
DYFYQLADSLGLLIWQDMMFACAMYPVNDEFLSSVREEVRQNAMRLSHHPSVAIFVTNNE
NEAALVQNWYGTLFERDRFESEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPD
NYISSNPQDNQNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDL
LGLITHRQHHPLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMATKVETELYRS
LRDTPHRTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYWARDFLAPISIVALYEKSTDS
LNISLICDQLEVDPRELNVVANVHLWSQLLPRQSTSWDVTLRPNGVQYDKVIAISDLLQG
EFTRTNAFLELQLRRGQDVISRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNS
VSISIQVKRPAVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRV
LTVNDFMR
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacggatgcggattactcaggaatggcaccacgggcgctgttatggtcggatta
gtttgtggcctttatgtttgcagcggccaatgtgataaggtggaagtaatagagctgagc
aattggacgataactaatcagaatggctccctgactattgccaaccaaacgttgcccttg
ggcatatacagtgccttcgcaccccaagtgctggactcctacaacgacgtcggtctgcgt
tacttggcctacgacaactttaccttctccaatttctttcagttcgacgttcatcacttc
aatcgcggccacatcaacctgacgtttcacggcattgacacggtgtcggaaatccggctg
aaccatcaactgctgggacgcacggacaacatgtttgtccgctactcttacgaagtgagt
tccctgctccaagcggaaaactttctggaagttgagatccaatctccagttgtggctgct
ttggcaagagccaatgctttaaaagaagctaaaaagagcgtgcctcccgaatgccccaac
gagcgctaccatggtgagtgccacatgaacatgctgcggaagatgcaggctagcttttcc
tgggactggggtcctgcagctccctctgctggaatctggaaaaacgtggagctggaaatc
tacgaggtggcggttattcgtgaggtggatgtggacgttagccgcgtcaatggttcgtac
tggaacatgcatattcgctgcttcctggacgcgggaggctggcaaaacttcaatggaaga
ctcgtcctatatgctgtcgagctattggaccgtccggtagtagtagacagatacgcaata
aaaaacatcagtcacttggcgccagtaattgaattcgatcaggccgtgccaaatgggaaa
gtcgtaacctggtggcccaatggctacggcgagcagaaactgtatccgctccacttcact
ctgaagacctggctgggacctgatggacccgaggttcgctctaagaccaagtcgcacaag
tcgctccgagtgggttttcgtacgcttgatctagtagaggatcccgcccctgacggcgtt
ggaaacaccttcctgtttcgagttaatggtgtagaaatgtttatgaaaggcagtaactac
ataccatcccacttattacccgaaatgcaaacaaatgaacagatttcacatttattaagg
tccgccaaggaagcccatatgaacatgcttcgagtctggggaggcggagtttacgaatcg
gactacttttaccagctcgccgacagcttgggtcttctaatttggcaagatatgatgttt
gcttgtgccatgtacccggttaacgacgaattcctatcgtcagtgcgtgaggaggttcgc
cagaatgccatgcgactatcacaccatccaagcgtagccatttttgtgaccaataacgaa
aacgaagctgctttggtacagaactggtacggcacgcttttcgaaagagatcgatttgag
agcgagtaccgggagctctaccttgctaatgtcatccacgagttgaagcttgtttcgcat
agctctcgacctcagccactggtctcctcaccttcaaatggcaaagctagtgaaccggac
aactatatttcgagcaaccctcaggataaccaaaatggcgatgtacatttctacgactac
actaaggacggctgggatccaggaattttcccacgtcctcgattcgtcagtgagttcggc
tttcagagctttccaggcgcatacgcatggcagcgcagcaagggcgaggacgatgacctc
ctcggcctgatcacacaccgacaacaccacccactgggaaatgttcctgttatcgcacta
gtggagagacacctaccgctgccctttccagagaatgagaactacgcgacagcactgatt
tacttcagccagattgctcaagccatggccacaaaggtggaaaccgaattataccgtagc
cttcgggacactccccacagaacgatgggggccctttactggcagctgaatgatgtatgg
gtggcgccatcctggtccagcattgatttctacggcaactggaagctgctccattactgg
gcacgtgattttctagcgcctatttcaatcgttgctctttacgaaaagtccacggattcg
ttaaacatctcccttatttgtgaccaattggaggtggacccaagggaactgaatgtcgta
gctaacgttcacctgtggtcccagcttctgcctcggcagtccacctcctgggatgttacc
ctgcgccccaatggcgtgcagtacgacaaggtcattgccatctccgatctgctgcaagga
gagttcaccagaactaacgcgtttttggagctgcagttgcgccgcgggcaggatgtgatc
tctaggacccacttctttcccagtagcattgccggagcagtcggaatagaggaccccggg
cttgagttcgagattgcctcccgtacctgtcttaacaccacaaacgtcgtccgcaacagc
gtcagcattagcatacaggtgaagcgccccgccgtatttgtatacctagagctgctcaag
ccataccgctacaccctgtccgagaacggatttatgcagactgagccaatgcatgtcgtc
tacctaacgttcgacgcacccttgtgcgcccgccttttgcgcaagtcggacctccgtgtg
ctgaccgtcaacgactttatgagatag

DBGET integrated database retrieval system