KEGG   Drosophila melanogaster (fruit fly): Dmel_CG13263Help
Entry
Dmel_CG13263      CDS       T00030                                 

Gene name
Cyt-c-d
Definition
Cytochrome c distal
Orthology
K08738  
cytochrome c
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dmel_CG13263 (Cyt-c-d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:36A11-36A11
AA seq 105 aa AA seqDB search
MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggtgatgcagagaacggcaagaagatatttgtgcagaagtgcgcccagtgc
cacacctacgaagtgggcggcaaacacaaggtgggcccaaatcttggcggggtcgtgggt
cgcaagtgtggcacagcagcgggatacaagtataccgatgccaatataaagaagggcgtt
acctggacagaggggaatttggacgagtacctcaaggacccgaagaaatacattcccgga
acaaagatggtgttcgcaggtcttaaaaaggctgaggagcgggccgatttgattgccttc
ctcaagtcaaacaagtag

DBGET integrated database retrieval system