KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1442Help
Entry
Dmel_CG1442       CDS       T00030                                 

Gene name
eIF4E-6
Definition
CG1442 gene product from transcript CG1442-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dme03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dme04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:98F5-98F5
AA seq 173 aa AA seqDB search
MENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDPEISWEDMLKEID
SFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAE
LDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDECNEQC
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttaaggcaaaccaaagagtcatcggaatttaaaatggggacttctctggat
aataacaaactggcatcgttgggtgccacaaacaagcaccggctgcagaacacatggacc
ctgtggggcgtaaagtacgaccctgaaatatcatgggaggacatgctgaaggagattgac
agcttcaataccgtcgaggacttctggaacctgtatttccgcatcgatacgccatccaag
ctcaaccgcggctgtgattacatgctcttcaagaagggcattcgccccatgtgggaggat
ccgccgaacaagggcggaggtcgttggacatataaagtggataaaaggtccacagccgaa
ctggacaaaacttggctggacgtgcttctttgcatgattggcgaggcctgcgatcactgc
gatcagatttgtggggcttttgtcaggattcgcaaaaatatcaacaaaatctccgtatgg
acaaaggcagacgcgggcgatgagtgtaacgaacagtgctaa

DBGET integrated database retrieval system