KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14476Help
Entry
Dmel_CG14476      CDS       T00030                                 

Definition
CG14476 gene product from transcript CG14476-RB (EC:3.2.1.20)
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dme00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dme04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:20A4-20A4
AA seq 924 aa AA seqDB search
MRFALATVAIIWALFVLADGVDPGNFKTCEQSSFCRRSRKIQGSGSKYALIPGTLNTYAD
SLTADLVNKENHHQFAFKLEALVGSTFRLQIDEKQPLRPRYRVEHALKGPTQAGRIRVQR
ETDGEIVITSEKNKAVIHGDPFRIDFFENDVLVVSVNAKNWLYFEHLRQKAQEPTSHPAE
NENQQEQDAAVETPKAADTIDDPGAWEENFKSHHDSKPYGPEAVALDFSFPAAKVLFGIP
EHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTAGVYWQNAAE
TWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAAL
TGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWD
KFKFPHPLAMIKNLTELGRHLVVIVDPHIKRDNNYFFHRDCTDRGYYVKTREGNDYEGWC
WPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVFNGPEITAPKDLIH
YGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADW
SHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKR
REPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVD
NQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDTYQRQERSGYVSVPVDDF
KIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQ
RIHVNYEFAHDQLVNSFVGKPKYKTLAWIERIVIAGLEKVPSSASITVNGVSQQLEVLHH
DNTVVVRKPGVKMDVDFAIKLNFA
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcgctctggccaccgtggccatcatctgggctttattcgtcctggccgacgga
gtggaccccgggaactttaagacctgcgagcagagcagtttttgtcgacgctcccgaaag
attcagggatcgggcagcaagtacgccttaattcccggcaccttgaacacctatgcggat
tcgttgaccgctgatctcgttaacaaggaaaaccatcaccagtttgcctttaagctagag
gctctggtgggcagtaccttccgcctgcagatcgatgaaaagcagccacttcggccacga
tatcgcgtcgagcacgctctgaagggcccaacccaggccggacgcattcgtgtccagcgg
gaaacagatggagagatcgttatcacatcggagaagaacaaggctgtgatccacggagac
ccgttccgcatcgatttcttcgagaacgacgtgctggtggtctcggtgaatgccaagaac
tggttgtactttgagcatctgcggcagaaggcccaggaaccgacctcccacccggcggaa
aacgagaatcagcaggagcaggatgccgctgtcgaaactcctaaagcagcagatactatc
gatgatcctggtgcatgggaggagaacttcaaatcacaccacgactctaagccctacggt
ccggaagctgtggctctggacttttcgttccccgcagccaaagttctattcggtattcca
gagcacgccgacagcttcatactaaagtccacctcgggtacggatccttaccgcctgtac
aacctggatgtgttcgaatacgttgtggacagcaagatggccctgtacggctcagtgccg
gtaatctatggtcatggagcgcaacgcacagcgggcgtttactggcagaatgccgctgaa
acttgggtggacattcaaacgtcggagaccaatgttgtatcttcgctggtaaattttgta
tccggctcgcagaagactcctcctccggctgcccactttatgtcggagtcgggcatcgtg
gacgccttcatcatgttgggacccaagcccatggacacttttaagcagtacgcggctctg
actggaacacacgagttacctcagttatttgctctggcctaccaccagagccgctggaac
tacaacgacgagagggacgtgacctccgtgtcagcgaaattcgacgagtacaatataccc
atggacaccatgtggctggacatcgagcatacagatggcaagcgctacttcacctgggac
aagttcaagttcccgcacccgctggcaatgatcaagaatcttacagaactgggtcgccac
ttggtggtgatagtcgacccgcacatcaagcgggataataattacttcttccaccgcgac
tgcacggatcgtggttattatgtgaaaacgcgcgagggcaatgattacgagggctggtgt
tggccgggagcggctagttatcctgatttctttaaccccgtggtcagagagtactacgcc
agccagtacgcgctggacaagttccaaacggtcaccgcagatgtgatgttgtggaacgac
atgaacgagccatcggtgttcaacggccctgagatcacggcgcccaaggacttgatccac
tacggcaactgggagcaccgtgacgtgcacaatttgtacggtcacatgcacttgatgggg
tccttcgcgggcctgcagcagcgcgatcccaaccagcggcccttcatcctcacacgcgcc
cactttgctggttcccagcgttatgctgccatttggacgggtgacaactttgcggactgg
tcgcatctacagcactcagtcaaaatgtgtctcacggaggcggtggccggcttctccttc
tgcggtgccgatgtcggtgccttctttggaaacccagatactgagctgctggagcgctgg
tatcaaaccggtgccttcctgccctttttccgggctcatgcacacatcgacactaagcgc
cgggagccatggcttttcccagaacgcactcgccaggttatccaaaatgctgtgatcaag
cgttattcatatctgcccctgtggtacaccgcattctacgagctggagctgactggcgag
ccggtaattcgcccattattagcccaatatccactggataaggaggccttcggcgttgac
aaccagctgttggtgcaagatcgcctgcttgtgagacccgtcatgcagcagggcgtcagc
aaggtggacgtgtacttcccggcaattgacgacaaaaagaatggcgactggtggtacgat
gtggatacttaccagcgccaggaacgatccggctatgtgtcggttccagtagatgatttc
aagatccccgtttggcagcgtggtggcagcattgtaccgaagaaggagcgacagcgccgc
gcctcaaccttgatgttgcacgatccgtacacactgataatctgcttagaccgtcagggc
aaggcatccggttccctctacctagacgacgagaagtcctacgcttaccgccagggccag
cgcatccacgtgaactacgagttcgcccacgaccagctggtcaatagcttcgtgggcaag
cccaagtacaagacccttgcctggatcgagcgaatcgtgatcgccggacttgagaaggtg
cccagcagcgccagcatcacggtgaatggtgtcagccagcagctggaggtgctccatcat
gataacaccgtcgtcgtgcgcaagccgggcgtcaagatggacgtcgacttcgccattaaa
ctcaactttgcgtag

DBGET integrated database retrieval system