KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14619Help
Entry
Dmel_CG14619      CDS       T00030                                 

Definition
CG14619 gene product from transcript CG14619-RH
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG14619
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG14619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:20C1-20C1
AA seq 938 aa AA seqDB search
MMLDIKKTRGFHKIPQASKLQSTTKTSSVVATSASSQNEVPSPGGSAGSKVGATNPVRAA
NQRFFLVSSYKDPTFLKAECDLAHAHVTTSKVKTTLQPHRRSRAGEDSRNNNYNTSRAPT
LINMRRPSLFNGNQQPTTTNSTTINNTTSRNTTSNTSNGVLKYSVRSTTATATSTSTRNY
GKLKPLNNNQTTAGVAMMNGHTNNNNNNTRNSSNINNGGNNNMQRQQQQHDDISFIDSDD
PPATGGPEAGISTTKTSICYFKPITPPLQLRHEQNQVQQQEEQPQPSSSKSASHRYPRPK
STIIASAHSNFAASFEKFSGGLYRQTNGETNIESKTSSNARRYGIDSLSIKASIEKFNNL
SGQKRQNPGSGSGIGPGSATASGLGGGRLSVASRSNHGSQAGGSSSNLQQRYSSDLDNIR
VAAGYSSSLTRAAYRTTATMNSVSTPVAVTSELGGPISGDGGETATAMGQPTSKVTVRGA
HSNRQPIECDSVVLTNKASKDATTAATPTVATATATHTPATSSVSTVTVTAAAPNSASDS
TLARSGTGSSSTARSVLPPMTPTSSRYWDRDSGTSRSSIGTSSALNSSSLKHNSDDGYKT
ASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQQILHE
FAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVK
GETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWD
LSVPLPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHL
KRFSETRWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALC
KHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYERT
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagacattaagaagaccagaggattccacaagattccacaggcatccaaatta
cagtcaacaacgaaaacatcatcagtagtagccacatcagcatcaagtcaaaacgaagtg
ccatcaccaggaggatcggctggatcaaaagttggagctaccaatccagtgcgagcggcc
aaccagcgcttcttcctagtgtccagctacaaggaccccacatttctgaaggccgaatgc
gacctggcccatgcccatgtgacaaccagcaaagtgaaaaccacgttgcaaccgcaccgg
cggagtcgtgctggtgaggattcaaggaacaacaactacaacactagccgggcaccaacg
ctgattaatatgcgacgcccgtctctgttcaatggcaatcagcaaccaaccaccaccaac
agcaccaccatcaacaacaccaccagcaggaacaccaccagtaacaccagcaacggggtg
ctcaagtacagcgtgcgctccacgacggcaactgcaacttcaacgtctaccaggaactac
ggcaagctgaaaccgctcaataacaaccaaacgaccgctggagtagctatgatgaatgga
cacaccaataataataacaacaacaccagaaacagcagcaacatcaacaacggtggcaat
aacaacatgcaacgccaacaacagcagcacgatgacataagcttcatagacagcgatgat
ccgccggcaactggtggccctgaagccggaatatcgacaaccaagacgagcatttgttac
ttcaagcccatcaccccgccgctgcagctgcggcacgagcaaaatcaagttcagcaacag
gaagaacagccgcagcccagcagctccaagtctgccagccatcgctatccacgacccaag
tccactattatagcatcggcccactcgaattttgcggccagctttgagaagtttagtggt
ggcctctataggcagaccaatggcgagacgaacattgagagcaagaccagtagcaatgcc
agaagatacggcattgattcattgagtattaaggcctcgatagagaagttcaacaacctc
agtggccagaagagacaaaatccgggctctggatcaggtataggacctggcagtgctaca
gcgtccggtttaggaggaggacggctgtctgtggctagccgtagcaatcacggatcgcag
gcaggcggtagcagcagcaatctgcagcagcgctacagcagcgatctggacaacatacgc
gtggcggctgggtatagtagttccctgaccagagcagcctatcggactacagccacaatg
aatagtgttagcacaccggtagcggtaacctctgaactaggcggtcctattagtggcgat
ggaggagaaaccgccacggcaatgggtcagcccacaagcaaggtaacggtgaggggtgct
cacagcaaccggcagccaatcgaatgcgatagcgtggtcttgaccaacaaggcaagcaag
gatgcaacgacagcggcaacacctactgttgccactgccacagcaacacatacaccagcc
acgtcttccgtatccacagtcacagtcaccgccgcagctccaaactccgccagcgatagt
acgttggcgagaagtggcactgggagtagcagcactgcccggagcgtcctgccgcccatg
acgcctacgtcaagtcggtactgggatcgggacagcggcaccagccgcagcagcataggc
acctcctccgcactgaactcgtcatccctgaaacataactcggatgatggctacaagacc
gcctcctcttcgcgggatgagaagtccgaaggtctgtgcggtctgcgaaacattgggaac
acttgctttatgaactcggtcatccagtgcctgagtcacactcaagagctgacccgcttc
ttgcggtcgcaccacggctctcgttcgttatccaccaaggatcagcagatactccacgaa
tttgccaaactcattcaggagatgtggaccgctaacgtgcacacggtgacgcccatggag
ctaaagagggcgttctcgaccaaacatcgcatgtacagcgactacaaccaacaggatgcg
caggagttcctgcgttttttccttgactcgctgcattcggccctcaattcgggcgtcaag
ggtgagacgctcaacattgacgataatctcagtgacaataagaaggcggacttgacctgg
gagtggtatacgcggcacgagaactctctggtgcgcgacctgtttgtgggtcagctcaaa
agcacactgaagtgcaccacctgcggtaacaccagcgtcacctttgatccgttctgggat
ctgagtgtaccgttgccgtcttcgtcccgctgcaagctagaagcttgcctcgacctcttt
atccgcgaagaggtccttgacggcgacgaaatgcccacgtgcgccaagtgcaagacacgg
cgaaaatgcaccaagagcttcaccattcaacgtttccccaaatatcttgttatacaccta
aaacgcttttcggagacacgctggagcaagctgtccaacatcgttgaatttcccacatca
gacagcgagctgaacatgggctcctatggcgccaactccaactcgaatgtgcattactcg
ctctatgcgatatccaatcatatggggtcaacggctggtggtcattatgttgccctttgc
aagcatccagtttcccgcaagtggcacgaatttaatgataatatagtcagcgatgccttg
tccgaaaaccatctcgtttcatccagtgcctatattcttttctacgagcgtacgtaa

DBGET integrated database retrieval system