KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14712Help
Entry
Dmel_CG14712      CDS       T00030                                 

Definition
CG14712 gene product from transcript CG14712-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG14712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86E13-86E13
AA seq 1266 aa AA seqDB search
MERRRFNMSSMSPMADSTRIDASLLNNRPAASNFLRGLSPKGSNTSLNGTRTPERSLMNR
SATSSSTITRQKLNLSQVDPRTFADVHSSGLSSRIVALSERSGLQRSMSASNLYNPLTQP
RRAPASPLPYKSRAPTLSITQIAPPERSFYSGNTLSSLLRSNSLVGLVPKTTEQEQLSRE
NRPILHPPHPQHESEPTRSVLEELKEISRKRINTEDTQQAQDYTKRSCQQNVDFVDFVAH
HRQQQKLRNLQQQQNQSFKRQRELTVSVPLRHHSTSLSAASPALQHMNSNGTISPTQSPE
QVAKRPNCSYSNDITSSLSSSCRHSNKRKLLDMRERFQHSKNDTLASGGSSPENSPENVA
KIQRKVDAEAVSKAMSMPVVTVAAVPASRAISAPAIQKAVPQVTEKPKLTLFNARQSQTI
AEQPRPDLSSPEVDAGEYAGIQFVKPKQQNSMLAAKNPSVERTHKTKLAIMLSGLKGELY
LGEPDELDAPAPKSAPAPVTLPTPVKPIIIAPVTTSTTTVTSTATISTSAPSKPIILSNQ
VIKPADVPNTNSTGSVPKLVLGQPAPPAKTEQTPPKPIDKVPAAQADIPPKFELSTKPVT
PATSSQPLISFGTPKSTAAPSFSFGSATNTTSSTIANITNTTTSKPIFSFGQTPANGPTV
GGLSGFKTEAPATTSVSTTNPGTQVTSTTTFGVTPPKTTTTVAPTTTVSLNFGQPMPSFG
AADTGVKPMFSFGKSNNLSSGTPTTNGSDAAAAKPAVFSFGGSTTQPAAAAPTPVFGSLS
KPLGEGFASPGANKSETTKPSIFGNLDNGLGNAMKSSTNVAATTAAELPKPFGFAATTTA
AGGGSTATNLFSFGGTATSKAAEPAPASQKNLFGLNATTTTPFAFGGAAAGAADKSENKD
NKPIAFAFGAGNNSAVANPSGVFSFGGTDKSAPPAFGSGTTSVTSATATPTNNTFGFSTT
QKPATPMFGSGSTQQSSTPAVAATKPFTLGGGAPTTPSASPASGGFSFSAVATKNTTAPT
AGTNLFGSPASASKPSFNFGGNTATQAAAAGSPAGGFSFATTTKKEDSASTNMFGSPNTG
VVKPNFSFSSNNPTPAPTFGGFGAPAAAAPTATSTNQSKPFAFGASTPAAAPQPPLGGNL
FANAVSATQNQTKPSGVFSFGAAKSTAGTTAGNAPFSFGGASAGGIASPPSNQGLNTAKP
FSFGGAGGTPAPNVFGSPAPAPPASNPTGGFNFGGVSPAQQANAGNMFAPTPESRPIRKA
TRRLQK
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacatgagcagcatgtcacccatggcggattccacgcggatt
gacgcgtcgctgttaaacaatcgtccggcggccagtaatttcctgaggggactgagtccc
aaggggtcgaatacctcgctcaatggcacacgcactccggagcggtccttgatgaatcgc
tctgccacatcgtccagtaccataacgcgacagaaactgaacctcagtcaggttgatccc
agaacctttgccgatgtgcatagcagcggactgtcatcccggatcgtggccttaagcgaa
cgcagtggtctgcaacgcagcatgtccgccagcaatctttacaatcccttgacgcagccg
cgcagagcgcccgcttccccgttgccctacaagtcaagggcgccgacgctttcgatcacg
cagattgcaccaccggagcgcagcttttattccggaaacacgctgtcaagcctgttgcga
tccaactccttggtagggttagtgccaaagaccaccgaacaggagcagctttcgagagag
aatcgacccatattgcacccacctcatccacagcatgagagcgagccaactagaagcgtg
ttggaggagcttaaggagatctcccgaaagcgcatcaacactgaagatacgcaacaggct
caagactacacgaaaaggagttgccagcaaaacgtggactttgtggactttgtggctcat
caccgtcagcaacagaaactacgtaatttgcagcaacaacagaatcagtcctttaaaagg
caacgagagctgacggtatcggttccgctcaggcatcattcgacatctttgtcggctgct
tctcctgcattgcaacatatgaactcgaatggaaccatctccccaacacaatctccggag
caggtagccaaacgtcccaattgtagctacagcaacgacatcacttcctcgctgagttcc
agttgccgtcacagcaacaagaggaagctgttggacatgcgagaaaggtttcagcacagc
aaaaacgacacactagctagtggaggaagctcgcctgagaactcgcccgaaaatgttgcc
aaaattcaacgtaaagttgatgcagaagctgttagcaaggcaatgagcatgcccgtcgtg
actgtggcggcagttcctgcttcacgagccatttcggctcctgccattcaaaaggcagtt
ccgcaggtgacggaaaaacctaagcttacactcttcaatgcgcgacaatctcaaacgata
gcggaacagccgcgacccgatttgagtagcccggaagtagatgccggcgaatatgcaggc
attcagttcgtgaagcctaaacagcagaattccatgctggctgccaagaaccctagcgta
gaacgcacacacaagaccaaactagccattatgctaagtggattgaagggcgaactgtac
ctgggtgagccggacgaactagatgccccagcgccgaagtcagcgccagcgcctgtgacg
cttcctactcccgtcaaacccatcatcatagctcctgtaaccacatccactacgaccgtt
acgtccaccgcaaccatatcaacttctgcgcccagcaagccgataatactaagtaaccag
gttataaagccagcagatgtgccaaatacgaatagcactggctcagtgcccaaacttgtg
cttggtcagcctgcgccgcccgctaaaacggaacaaacaccaccaaaacccatcgacaag
gtcccggcagcacaagcagatatcccacccaagtttgagctatcaaccaaacccgttact
ccagcaacatcatctcaaccactaatcagttttggcacaccaaaatccacagcagcacca
tcattctcgtttggaagtgcgaccaataccactagtagcactattgctaatatcaccaat
actaccacatcaaagcccatattctcgttcggacaaacgcctgccaatggtcccacagta
ggcggcctttctggattcaaaactgaagctccagcaacaacttcggttagcacaactaat
cctgggacacaggttacatcaacaactactttcggagtgacaccacccaaaacgacgact
acagttgctccgactacaactgtatcgctaaatttcggccagccgatgccatcatttgga
gcagcagacacgggggtgaaaccgatgttctcctttggtaaatcgaacaatttaagttca
ggaactccgacaacaaatggcagcgatgcagctgccgccaagcctgctgtattcagtttt
ggaggtagcaccactcagcccgctgcagctgcaccgacaccggtattcggaagcctatcg
aaacccctaggcgaaggttttgcatcgcccggggctaacaaatccgagacaactaagccg
agcatttttggcaatttggacaacggacttggaaacgcaatgaagtcatcaactaatgta
gcagccacaaccgccgccgagcttcccaagccatttggcttcgcagctacaacaaccgct
gctggcggaggatcaactgccacaaatctcttttcatttggagggacggccacttcaaag
gcagcggaaccagctccagctagccaaaaaaacctttttggactaaatgcaaccacaact
acgccctttgcattcggaggagcagcagcgggcgccgcagataaaagtgaaaataaggac
aacaaaccaattgcatttgcatttggtgcaggtaacaacagtgcggtagccaacccaagt
ggagtatttagctttggtggcacggacaagagtgcaccaccagcctttggcagcggaaca
acatctgttacatctgccacagcaacaccgacgaacaacacctttgggtttagcacgact
cagaagcctgcaacaccaatgttcggaagtggatcaacgcaacagtcttcgacaccggca
gtggcagccaccaaaccttttacacttggtggtggggctcctactacaccgtcagcatct
ccagcatctggaggattctcgttttccgccgttgcgaccaaaaatactacggcgccaaca
gcaggaacaaatttgtttggcagccccgccagcgccagcaagccaagcttcaactttgga
ggaaacaccgccacccaggcggcggcagcaggatcaccagctggtggcttctcattcgcc
acgaccaccaagaaggaggactcagcaagcaccaatatgtttgggagccccaacaccgga
gtggtgaagcctaactttagcttttcaagcaacaatccaactccagcgcctacctttggc
ggattcggtgctccagcagcggctgcaccaacagcaacttcaactaatcagagcaagccc
tttgcatttggggctagcactccggctgctgccccccagccgcccttgggcggcaatctt
tttgccaacgcagtgtctgctacccaaaaccaaacaaagccgtcaggagtcttctcattt
ggtgcggctaagagcaccgccggcaccacagccggcaatgctcccttctcgtttggaggc
gcatctgctggcggaatcgcctcgccgcccagcaatcagggtttaaataccgcaaagcca
ttcagctttggtggcgctggcggcactccagccccgaatgtctttgggagcccagcccct
gcaccgccagcaagcaatccaaccgggggcttcaactttggcggcgtcagtccggcccag
caggcgaatgccggcaacatgtttgcccccacaccggagagtcgtccgatacgaaaggcc
actaggcgtctgcagaaataa

DBGET integrated database retrieval system