KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14712Help
Entry
Dmel_CG14712      CDS       T00030                                 

Gene name
CG14712
Definition
(RefSeq) uncharacterized protein
  KO
K14316  
nuclear pore complex protein Nup121
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG14712 (CG14712)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dmel_CG14712 (CG14712)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1266 aa AA seqDB search
MERRRFNMSSMSPMADSTRIDASLLNNRPAASNFLRGLSPKGSNTSLNGTRTPERSLMNR
SATSSSTITRQKLNLSQVDPRTFADVHSSGLSSRIVALSERSGLQRSMSASNLYNPLTQP
RRAPASPLPYKSRAPTLSITQIAPPERSFYSGNTLSSLLRSNSLVGLVPKTTEQEQLSRE
NRPILHPPHPQHESEPTRSVLEELKEISRKRINTEDTQQAQDYTKRSCQQNVDFVDFVAH
HRQQQKLRNLQQQQNQSFKRQRELTVSVPLRHHSTSLSAASPALQHMNSNGTISPTQSPE
QVAKRPNCSYSNDITSSLSSSCRHSNKRKLLDMRERFQHSKNDTLASGGSSPENSPENVA
KIQRKVDAEAVSKAMSMPVVTVAAVPASRAISAPAIQKAVPQVTEKPKLTLFNARQSQTI
AEQPRPDLSSPEVDAGEYAGIQFVKPKQQNSMLAAKNPSVERTHKTKLAIMLSGLKGELY
LGEPDELDAPAPKSAPAPVTLPTPVKPIIIAPVTTSTTTVTSTATISTSAPSKPIILSNQ
VIKPADVPNTNSTGSVPKLVLGQPAPPAKTEQTPPKPIDKVPAAQADIPPKFELSTKPVT
PATSSQPLISFGTPKSTAAPSFSFGSATNTTSSTIANITNTTTSKPIFSFGQTPANGPTV
GGLSGFKTEAPATTSVSTTNPGTQVTSTTTFGVTPPKTTTTVAPTTTVSLNFGQPMPSFG
AADTGVKPMFSFGKSNNLSSGTPTTNGSDAAAAKPAVFSFGGSTTQPAAAAPTPVFGSLS
KPLGEGFASPGANKSETTKPSIFGNLDNGLGNAMKSSTNVAATTAAELPKPFGFAATTTA
AGGGSTATNLFSFGGTATSKAAEPAPASQKNLFGLNATTTTPFAFGGAAAGAADKSENKD
NKPIAFAFGAGNNSAVANPSGVFSFGGTDKSAPPAFGSGTTSVTSATATPTNNTFGFSTT
QKPATPMFGSGSTQQSSTPAVAATKPFTLGGGAPTTPSASPASGGFSFSAVATKNTTAPT
AGTNLFGSPASASKPSFNFGGNTATQAAAAGSPAGGFSFATTTKKEDSASTNMFGSPNTG
VVKPNFSFSSNNPTPAPTFGGFGAPAAAAPTATSTNQSKPFAFGASTPAAAPQPPLGGNL
FANAVSATQNQTKPSGVFSFGAAKSTAGTTAGNAPFSFGGASAGGIASPPSNQGLNTAKP
FSFGGAGGTPAPNVFGSPAPAPPASNPTGGFNFGGVSPAQQANAGNMFAPTPESRPIRKA
TRRLQK
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacatgagcagcatgtcacccatggcggattccacgcggatt
gacgcgtcgctgttaaacaatcgtccggcggccagtaatttcctgaggggactgagtccc
aaggggtcgaatacctcgctcaatggcacacgcactccggagcggtccttgatgaatcgc
tctgccacatcgtccagtaccataacgcgacagaaactgaacctcagtcaggttgatccc
agaacctttgccgatgtgcatagcagcggactgtcatcccggatcgtggccttaagcgaa
cgcagtggtctgcaacgcagcatgtccgccagcaatctttacaatcccttgacgcagccg
cgcagagcgcccgcttccccgttgccctacaagtcaagggcgccgacgctttcgatcacg
cagattgcaccaccggagcgcagcttttattccggaaacacgctgtcaagcctgttgcga
tccaactccttggtagggttagtgccaaagaccaccgaacaggagcagctttcgagagag
aatcgacccatattgcacccacctcatccacagcatgagagcgagccaactagaagcgtg
ttggaggagcttaaggagatctcccgaaagcgcatcaacactgaagatacgcaacaggct
caagactacacgaaaaggagttgccagcaaaacgtggactttgtggactttgtggctcat
caccgtcagcaacagaaactacgtaatttgcagcaacaacagaatcagtcctttaaaagg
caacgagagctgacggtatcggttccgctcaggcatcattcgacatctttgtcggctgct
tctcctgcattgcaacatatgaactcgaatggaaccatctccccaacacaatctccggag
caggtagccaaacgtcccaattgtagctacagcaacgacatcacttcctcgctgagttcc
agttgccgtcacagcaacaagaggaagctgttggacatgcgagaaaggtttcagcacagc
aaaaacgacacactagctagtggaggaagctcgcctgagaactcgcccgaaaatgttgcc
aaaattcaacgtaaagttgatgcagaagctgttagcaaggcaatgagcatgcccgtcgtg
actgtggcggcagttcctgcttcacgagccatttcggctcctgccattcaaaaggcagtt
ccgcaggtgacggaaaaacctaagcttacactcttcaatgcgcgacaatctcaaacgata
gcggaacagccgcgacccgatttgagtagcccggaagtagatgccggcgaatatgcaggc
attcagttcgtgaagcctaaacagcagaattccatgctggctgccaagaaccctagcgta
gaacgcacacacaagaccaaactagccattatgctaagtggattgaagggcgaactgtac
ctgggtgagccggacgaactagatgccccagcgccgaagtcagcgccagcgcctgtgacg
cttcctactcccgtcaaacccatcatcatagctcctgtaaccacatccactacgaccgtt
acgtccaccgcaaccatatcaacttctgcgcccagcaagccgataatactaagtaaccag
gttataaagccagcagatgtgccaaatacgaatagcactggctcagtgcccaaacttgtg
cttggtcagcctgcgccgcccgctaaaacggaacaaacaccaccaaaacccatcgacaag
gtcccggcagcacaagcagatatcccacccaagtttgagctatcaaccaaacccgttact
ccagcaacatcatctcaaccactaatcagttttggcacaccaaaatccacagcagcacca
tcattctcgtttggaagtgcgaccaataccactagtagcactattgctaatatcaccaat
actaccacatcaaagcccatattctcgttcggacaaacgcctgccaatggtcccacagta
ggcggcctttctggattcaaaactgaagctccagcaacaacttcggttagcacaactaat
cctgggacacaggttacatcaacaactactttcggagtgacaccacccaaaacgacgact
acagttgctccgactacaactgtatcgctaaatttcggccagccgatgccatcatttgga
gcagcagacacgggggtgaaaccgatgttctcctttggtaaatcgaacaatttaagttca
ggaactccgacaacaaatggcagcgatgcagctgccgccaagcctgctgtattcagtttt
ggaggtagcaccactcagcccgctgcagctgcaccgacaccggtattcggaagcctatcg
aaacccctaggcgaaggttttgcatcgcccggggctaacaaatccgagacaactaagccg
agcatttttggcaatttggacaacggacttggaaacgcaatgaagtcatcaactaatgta
gcagccacaaccgccgccgagcttcccaagccatttggcttcgcagctacaacaaccgct
gctggcggaggatcaactgccacaaatctcttttcatttggagggacggccacttcaaag
gcagcggaaccagctccagctagccaaaaaaacctttttggactaaatgcaaccacaact
acgccctttgcattcggaggagcagcagcgggcgccgcagataaaagtgaaaataaggac
aacaaaccaattgcatttgcatttggtgcaggtaacaacagtgcggtagccaacccaagt
ggagtatttagctttggtggcacggacaagagtgcaccaccagcctttggcagcggaaca
acatctgttacatctgccacagcaacaccgacgaacaacacctttgggtttagcacgact
cagaagcctgcaacaccaatgttcggaagtggatcaacgcaacagtcttcgacaccggca
gtggcagccaccaaaccttttacacttggtggtggggctcctactacaccgtcagcatct
ccagcatctggaggattctcgttttccgccgttgcgaccaaaaatactacggcgccaaca
gcaggaacaaatttgtttggcagccccgccagcgccagcaagccaagcttcaactttgga
ggaaacaccgccacccaggcggcggcagcaggatcaccagctggtggcttctcattcgcc
acgaccaccaagaaggaggactcagcaagcaccaatatgtttgggagccccaacaccgga
gtggtgaagcctaactttagcttttcaagcaacaatccaactccagcgcctacctttggc
ggattcggtgctccagcagcggctgcaccaacagcaacttcaactaatcagagcaagccc
tttgcatttggggctagcactccggctgctgccccccagccgcccttgggcggcaatctt
tttgccaacgcagtgtctgctacccaaaaccaaacaaagccgtcaggagtcttctcattt
ggtgcggctaagagcaccgccggcaccacagccggcaatgctcccttctcgtttggaggc
gcatctgctggcggaatcgcctcgccgcccagcaatcagggtttaaataccgcaaagcca
ttcagctttggtggcgctggcggcactccagccccgaatgtctttgggagcccagcccct
gcaccgccagcaagcaatccaaccgggggcttcaactttggcggcgtcagtccggcccag
caggcgaatgccggcaacatgtttgcccccacaccggagagtcgtccgatacgaaaggcc
actaggcgtctgcagaaataa

DBGET integrated database retrieval system