KEGG   Drosophila melanogaster (fruit fly): Dmel_CG14887Help
Entry
Dmel_CG14887      CDS       T00030                                 

Gene name
Dhfr
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmel_CG14887 (Dhfr)
   00670 One carbon pool by folate
    Dmel_CG14887 (Dhfr)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dmel_CG14887 (Dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:89B18-89B18
AA seq 182 aa AA seqDB search
MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTSDPTKQNAVVMGRKTYFGVP
ESKRPLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILEEQNEVENIWIVGGSGVYEE
AMASPRCHRLYITKIMQKFDCDTFFPAIPDSFREVAPDSDMPLGVQEENGIKFEYKILEK
HS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgattcaatttaatcgtggcagtttgcgagaatttcggaatcggcatcagaggc
gatctaccatggcgcattaaatctgagctgaagtacttcagccgcaccaccaagcgaaca
agtgatcccaccaagcaaaatgccgtggtaatgggcaggaaaacctacttcggagtgccg
gaaagcaagaggcctcttcccgatcggctgaacatagtgctgagcaccacacttcaggaa
agtgatctgcccaagggagtactattgtgccccaatctcgagacggccatgaagatcctt
gaggagcagaacgaagtggagaacatttggattgtgggcggtagtggagtctacgaggag
gccatggcctcgccaaggtgtcaccggctgtacattaccaaaataatgcagaagttcgat
tgcgacacctttttccccgcgatccctgacagctttcgagaggtcgcgcccgattccgac
atgccactgggtgtgcaggaggagaatggcattaaattcgagtacaagattttggagaaa
cactcataa

DBGET integrated database retrieval system