KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1490Help
Entry
Dmel_CG1490       CDS       T00030                                 

Gene name
Usp7
Definition
ubiquitin-specific protease 7 (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dme04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11A1-11A2
AA seq 1129 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQTQQQRNSPPQLPKFKNLIQPQLHAVGAVTQL
PSENGNMPPQQLLADSSSTSFGDGEAMGIDDESKEDQFRSETTFSFTVENVVQLKSQRLS
PPVYVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDAQPFTRAR
IKHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHVVADAPHGVLWDSKKHTGY
VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGDRP
VGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIK
CKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV
IFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVL
VHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNA
YMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEE
NFEEQHKRRLFDLEKVHPRVFRIKQNQTVDELVDLFVRGFGVSRQRMRMWNLCTAQTQKF
SHFDFVAEGSRTIEQISTSQKPWVIWLQLAWTDVPGPLPPFNPKTESLLFLKYYDPRNKR
LNYIGCTQQPHTRRLIDLVPDVNSKLGFEPDTELTIYDEYADKKLVNLNEPIESALFIPQ
DHLQGHILIFERENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFTLELSNRYNY
DQLANAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKQSSTKRIFY
QRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRR
KLRLLKISNHKIVAVCKDDIPLDTLLKSNESITTAQGAQKTFRIEEVPAEDMQLAENEFL
IPVAHFSKELYNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGHNA
DVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcgatggacacccaggacacccaagaggtc
gagatcctcaccagtgacctacaacagacacagcagcagcgaaattcaccgcctcaattg
ccgaaattcaagaatcttatccagccacaattgcatgccgttggtgcagtgacccagttg
cccagcgagaacggcaatatgccgccacaacaactattggccgatagcagctccacttca
ttcggcgatggcgaggccatgggcattgacgatgagtccaaggaggatcagttccgttcg
gagacgacattctcctttaccgtcgagaatgtggtacaattgaaatcgcagagactatcg
ccgccagtttatgtccgcatgctgccatggcggatcatggtcatacccaatgatcgagcg
ctcggcttctttctgcagtgcaacggggagaatgattcgcccacctggtcgtgcaatgcc
attgccgagctgcgtttgaagtgccacaagccggatgcacagccattcacacgtgcccgg
attaagcatttgttctactccaaggagaatgactatggctactcgaattttatcacctgg
caggagctgaaggattccgaaaagagctatgtgcacaataatagcattaccctggaggtt
cacgtcgttgcggatgcaccgcatggcgttctgtgggactccaagaagcacacaggctat
gttggccttaaaaatcagggcgccacttgctatatgaactcgctgctgcagacattgtac
ttcaccaattcgctaagactgtctgtgtatcgcatacccacggaggctgacgatagttcc
aaatccgttggattatcgctgcagcgtgtgttccatgaattgcagtttggtgaccgtccc
gttggcaccaaaaagttaaccaaatcctttggctgggagacgctcgattcgtttatgcag
cacgatgtccaggagtttctgcgcgtgctgctcgacaagctcgagtcgaagatgaagggc
accatcctggagggcaccataccgggtctgtttgagggcaaaatgtcgtcgtacattaag
tgcaagaacgtcgattacaatagcacacgctacgagacgttctacgacattcagctgaac
atcaaggataagaagaacatctacgaatcctttcaggattacgtagcccccgaaacgctg
gagggtgacaacaaatacgatgctggtgtgcatggcttgcaggaagccagcaagggcgtc
atcttcacttcattcccacccgttttgcatctgcacctgatgcgcttccagtacgatccc
gtcacggatagctcgatcaagtacaacgatcgtttcgagttctacgaacacatcaatctg
gatcgctatctggccgagagtgagaataccttggcggactacgttctacacgccgtgctg
gtgcattcgggcgataaccatggcgggcactatgtggtcttcattaatccaaaggctgac
ggacgttggtttaagttcgacgacgatgtggtctccagttgccgcaaacaggaggcgatc
gaacagaactacggcggcatggacgatgagatctcgtttcatgccaagtgcagcaatgcc
tatatgctggtctacatccgacagtcggagttggatcgcgtccttggcgacataacggaa
agcgagatatcaagcgatctggtggagcggctcgatctggagaaacgaatcgaaatggcg
cgacgcaaagagcgcggcgaggccaacacatatgtgtccgtgcacgtaatcctcgaggag
aacttcgaggaacagcacaagcgtcgtctcttcgatctggagaaggtccatccgcgcgtc
ttccgcatcaaacaaaatcagactgtcgacgagctggtggacttgtttgtcaggggtttc
ggagtgtcgcgccaacgtatgcgcatgtggaacttgtgcaccgcccagacgcaaaagttt
tcgcatttcgatttcgtggcggagggatcacgcaccatcgagcagatatcaacgtcacag
aaaccgtgggtcatctggctgcagctggcctggacggatgtacctggtcccctgccgccc
tttaatcccaagaccgaatccctgctgttcctcaaatactatgatccgcgcaataagcgg
ctaaattatattggatgtacccaacagccgcacacccgccgactcattgatctggtgccg
gatgttaatagcaaactgggcttcgaaccggacaccgagctgaccatctacgatgagtat
gccgacaagaagctggtcaatctgaatgagcccatcgagagtgcgctgttcataccgcag
gatcatctgcaaggccacattttaatcttcgagcgcgaaaacgttgacgccaaactcgac
ctgcccacggtaggggattacttcctggatctagtctaccgcatcgagatcatcttcagc
gacaaatgcaatcccaatgaaccggactttacgctggagctgtccaatcgctataattac
gatcagctcgccaatgcggtggccgagcgcttgaataccgatccacagaagctgcagttc
ttcatgtgcatcaacaactacaaggagacggcgggcaatgctgtaccctacacatttaag
ggcaccatcaaggatctggtttcttacaccaaacagagctcaaccaagcgtatcttctat
caacgactatcgcttagcatccacgagctggataataagaagcagttcaagtgcgtctgg
gtgagcagtgatcttaaggacgaaaaggagctggtactttaccccaataagaacgatacg
gtgaaaggattgctggaggaggcggcaaagaaaatctcgtttgcggagaacagccgtcgc
aaattgcgcctgttgaagattagcaatcataagattgtggcggtatgcaaggacgatata
ccgctggatacgctgctaaagtccaacgagtcaataacgaccgcacagggcgctcaaaag
acttttcgcatcgaggaggtgccggcggaggatatgcaactggcggagaatgagttcctc
ataccagtggcccatttcagcaaagagctgtacaactcattcggcatacccttcctaacc
aaggcgcgccaaggtgagccatacggtgcacttaagcagcgcatccagcgtcgtctgaat
gtgcaggacaaggagtgggaaaactacaaattctgcgtaatctctatgggtcacaatgcg
gatgttaatgacaatacgcccgttgatctggaggtttatcgctcgtggaccagcggccag
ttgcccttctttggcttggatcacatcaacaagtcgcgtaagcgcagttcgcttaacttc
tccgagaaggccatcaagatatataactag

DBGET integrated database retrieval system