KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1490Help
Entry
Dmel_CG1490       CDS       T00030                                 

Gene name
Usp7
Definition
Ubiquitin-specific protease 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG1490 (Usp7)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG1490 (Usp7)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG1490 (Usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11A1-11A2
AA seq 1125 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQTQQQRNSPPQLPKFKNLIQPQLHAVGAVTQL
PSENGNMPPQQLLADSSSTSFGDGEAMGIDDESKEDQFRSETTFSFTVENVVQLKSQRLS
PPVYVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDAQPFTRAR
IKHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHVVADAPHGVLWDSKKHTGY
VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFGDRP
VGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIK
CKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV
IFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESENTLADYVLHAVL
VHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNA
YMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEE
NFEEQHKRRLFDLEKVHPRVFRIKQNQTVDELVDLFVRGFGVSRQRMRMWNLCTAQTQKF
SHFDFVAEGSRTIEQISTSQKPWVIWLQLAWTDVPGPLPPFNPKTESLLFLKYYDPRNKR
LNYIGCTQQPHTRRLIDLVPDVNSKLGFEPDTELTIYDEYADKKLVNLNEPIESALFIPQ
DHLQGHILIFERENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFTLELSNRYNY
DQLANAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKDLVSYTKQSSTKRIFYQRLS
LSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRRKLRL
LKISNHKIVAVCKDDIPLDTLLKSNESITTAQGAQKTFRIEEVPAEDMQLAENEFLIPVA
HFSKELYNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGHNADVND
NTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcgatggacacccaggacacccaagaggtc
gagatcctcaccagtgacctacaacagacacagcagcagcgaaattcaccgcctcaattg
ccgaaattcaagaatcttatccagccacaattgcatgccgttggtgcagtgacccagttg
cccagcgagaacggcaatatgccgccacaacaactattggccgatagcagctccacttca
ttcggcgatggcgaggccatgggcattgacgatgagtccaaggaggatcagttccgttcg
gagacgacattctcctttaccgtcgagaatgtggtacaattgaaatcgcagagactatcg
ccgccagtttatgtccgcatgctgccatggcggatcatggtcatacccaatgatcgagcg
ctcggcttctttctgcagtgcaacggggagaatgattcgcccacctggtcgtgcaatgcc
attgccgagctgcgtttgaagtgccacaagccggatgcacagccattcacacgtgcccgg
attaagcatttgttctactccaaggagaatgactatggctactcgaattttatcacctgg
caggagctgaaggattccgaaaagagctatgtgcacaataatagcattaccctggaggtt
cacgtcgttgcggatgcaccgcatggcgttctgtgggactccaagaagcacacaggctat
gttggccttaaaaatcagggcgccacttgctatatgaactcgctgctgcagacattgtac
ttcaccaattcgctaagactgtctgtgtatcgcatacccacggaggctgacgatagttcc
aaatccgttggattatcgctgcagcgtgtgttccatgaattgcagtttggtgaccgtccc
gttggcaccaaaaagttaaccaaatcctttggctgggagacgctcgattcgtttatgcag
cacgatgtccaggagtttctgcgcgtgctgctcgacaagctcgagtcgaagatgaagggc
accatcctggagggcaccataccgggtctgtttgagggcaaaatgtcgtcgtacattaag
tgcaagaacgtcgattacaatagcacacgctacgagacgttctacgacattcagctgaac
atcaaggataagaagaacatctacgaatcctttcaggattacgtagcccccgaaacgctg
gagggtgacaacaaatacgatgctggtgtgcatggcttgcaggaagccagcaagggcgtc
atcttcacttcattcccacccgttttgcatctgcacctgatgcgcttccagtacgatccc
gtcacggatagctcgatcaagtacaacgatcgtttcgagttctacgaacacatcaatctg
gatcgctatctggccgagagtgagaataccttggcggactacgttctacacgccgtgctg
gtgcattcgggcgataaccatggcgggcactatgtggtcttcattaatccaaaggctgac
ggacgttggtttaagttcgacgacgatgtggtctccagttgccgcaaacaggaggcgatc
gaacagaactacggcggcatggacgatgagatctcgtttcatgccaagtgcagcaatgcc
tatatgctggtctacatccgacagtcggagttggatcgcgtccttggcgacataacggaa
agcgagatatcaagcgatctggtggagcggctcgatctggagaaacgaatcgaaatggcg
cgacgcaaagagcgcggcgaggccaacacatatgtgtccgtgcacgtaatcctcgaggag
aacttcgaggaacagcacaagcgtcgtctcttcgatctggagaaggtccatccgcgcgtc
ttccgcatcaaacaaaatcagactgtcgacgagctggtggacttgtttgtcaggggtttc
ggagtgtcgcgccaacgtatgcgcatgtggaacttgtgcaccgcccagacgcaaaagttt
tcgcatttcgatttcgtggcggagggatcacgcaccatcgagcagatatcaacgtcacag
aaaccgtgggtcatctggctgcagctggcctggacggatgtacctggtcccctgccgccc
tttaatcccaagaccgaatccctgctgttcctcaaatactatgatccgcgcaataagcgg
ctaaattatattggatgtacccaacagccgcacacccgccgactcattgatctggtgccg
gatgttaatagcaaactgggcttcgaaccggacaccgagctgaccatctacgatgagtat
gccgacaagaagctggtcaatctgaatgagcccatcgagagtgcgctgttcataccgcag
gatcatctgcaaggccacattttaatcttcgagcgcgaaaacgttgacgccaaactcgac
ctgcccacggtaggggattacttcctggatctagtctaccgcatcgagatcatcttcagc
gacaaatgcaatcccaatgaaccggactttacgctggagctgtccaatcgctataattac
gatcagctcgccaatgcggtggccgagcgcttgaataccgatccacagaagctgcagttc
ttcatgtgcatcaacaactacaaggagacggcgggcaatgctgtaccctacacatttaag
gatctggtttcttacaccaaacagagctcaaccaagcgtatcttctatcaacgactatcg
cttagcatccacgagctggataataagaagcagttcaagtgcgtctgggtgagcagtgat
cttaaggacgaaaaggagctggtactttaccccaataagaacgatacggtgaaaggattg
ctggaggaggcggcaaagaaaatctcgtttgcggagaacagccgtcgcaaattgcgcctg
ttgaagattagcaatcataagattgtggcggtatgcaaggacgatataccgctggatacg
ctgctaaagtccaacgagtcaataacgaccgcacagggcgctcaaaagacttttcgcatc
gaggaggtgccggcggaggatatgcaactggcggagaatgagttcctcataccagtggcc
catttcagcaaagagctgtacaactcattcggcatacccttcctaaccaaggcgcgccaa
ggtgagccatacggtgcacttaagcagcgcatccagcgtcgtctgaatgtgcaggacaag
gagtgggaaaactacaaattctgcgtaatctctatgggtcacaatgcggatgttaatgac
aatacgcccgttgatctggaggtttatcgctcgtggaccagcggccagttgcccttcttt
ggcttggatcacatcaacaagtcgcgtaagcgcagttcgcttaacttctccgagaaggcc
atcaagatatataactag

DBGET integrated database retrieval system