KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15111Help
Entry
Dmel_CG15111      CDS       T00030                                 

Gene name
CG15111
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Dmel_CG15111 (CG15111)
Peptidases [BR:dme01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Dmel_CG15111 (CG15111)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Dmel_CG15111 (CG15111)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 393 aa AA seqDB search
MLFTRRRLLKRVGLRCLQACLLIFFLIFVVLPLIFRYSVTFQRGILFLTFIKYPKGLDLT
KPESVGLYATRNFYITVKDHDQDEDGVRVGVWHVLPSNAVRRFKRELRVEEEVAQDPDQQ
LDPAPGNERELKELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGH
RSEVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTSNPIVVWGH
SLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHPFAKLYKNLPWFNFTISQP
MYTNRLRFESDVHVLEFRQPIMIIHAEDDVVVPFNLGYRLYRIALDGRSRTSGPVEFHRF
GASRKYGHKYLCRAPELPGLIQKFVENYRDAVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcacgcgccggcgactcctcaaaagggtgggtctgcgatgtctgcaagcttgt
ctgctgatcttcttcctgatcttcgtggtcctaccgttgatctttcggtattccgtaacg
ttccagcgtggcatcctatttctgacatttattaagtatcccaaaggacttgatctcacc
aagccggaaagcgtgggtctttatgccacacgaaacttctacataaccgtaaaggatcac
gatcaggacgaggatggagtgcgagttggtgtgtggcacgtgctgcccagcaatgcagtg
cgtcgttttaagcgcgaactgcgcgtggaggaggaagtggcccaggacccggatcagcag
ctggatcctgcacctggcaacgaacgcgagctgaaggagctatcgccagccatacgatct
gaatttcccgtcgtgctgccggaaaacgagcagctcttctatgagcgattgctgcggatg
cccggcggtactgtggtcctctatcttcatgggaacacagccagccggggcagtggtcac
cgatcggaggtgtataagctactgcgaaagctcaactatcatgtgttctccttcgactac
agaggctatgccgactccgatcccgtacctccgacggaggaaggcgttgtgcgcgatgcc
atgatggtttttgaatacatagccaacaccacctccaatccgattgtggtctggggccat
tcccttggcaccggagtggccacgcatctgtgcgccaagctagctagcctacgggaaagg
gctcccaggggagtgatcctcgaaagcccgttcaccaacattcgggacgagatacgcatg
catccgtttgccaaactctataagaatctgccctggttcaattttaccatctcgcaacca
atgtacaccaataggctgagatttgagtcggatgttcatgtcttggagttccggcaaccc
atcatgatcatccatgctgaggacgatgtcgtggtgccgtttaatctgggctatcgtctg
tataggatcgcattggatggcagaagtcgaacctcgggacctgtggagttccatcgcttt
ggggcgagccgaaagtatggacacaaatacctctgccgagcaccggaattgccgggactg
atccaaaagtttgtggagaactaccgtgacgccgtatactag

DBGET integrated database retrieval system