KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15319Help
Entry
Dmel_CG15319      CDS       T00030                                 

Gene name
nej
Definition
nejire (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG15319 (nej)
   04330 Notch signaling pathway
    Dmel_CG15319 (nej)
   04350 TGF-beta signaling pathway
    Dmel_CG15319 (nej)
   04630 Jak-STAT signaling pathway
    Dmel_CG15319 (nej)
   04068 FoxO signaling pathway
    Dmel_CG15319 (nej)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG15319 (nej)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dmel_CG15319 (nej)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dmel_CG15319 (nej)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:8F7-8F9
AA seq 3282 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINSVSVPGGPGAGAGGVGAGGGGAVAANQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGASGGAGGPGNGPGGGGPRMQNPNMQMNFRPFAAQLNSLPYGVGQYGGPGG
GNNPQQQQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPAGQLVSG
NPQQQQMLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQQPGTSQQQQQQQGVGIGGAGVV
ANAGTVAGVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENL
NPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPF
RQNHSVFQNANVPPGGGPAGIGGAPPGGGGAGGGAAGAGGNLQQQQQQQQQQQQNQQPNL
TGLVVDGKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVH
QQQVQQQELRRFDGMSQQVVAGGMQQQQQQGLPPVIRIQGAQPAVRVLGPGGPGGPSGPN
VLPNDVNSLHQQQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQQQQPNPAQLGGNIPA
PLSVNVGGFGNTNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGASGGQVA
AGSSVLMPADTTGSGNAGNPNQNAGGVAGGAGGGNGGNTGPPGDNEKDWRESVTADLRNH
LVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQK
ELEEKRLKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQQ
QGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHS
PGGNMLALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTTNVLT
SPVPGQQQQQQFINANGGTGANPQLSEIMKQRHIHQQQQQQQQQQQQGMLLPQSPFSNST
PLQQQQQQQQQQQQQQQATSNSFSSPMQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNA
GAGAPGTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNNSSANNNPPSVSSLMQQPLS
NRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSS
SAGSGTPLSSVSTPTSATMATSSGGGGGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGA
TTTTSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASK
GKLDSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEDGL
DGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGATGGAVDIKPKT
ETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGI
PDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLS
EVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASN
RYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQ
ICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAG
AGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMH
VQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWA
CPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGS
AAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKK
GQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASL
APIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYT
CNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEA
RKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCC
YHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAV
SGPTVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGAGGMG
GMTSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMN
RPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMN
VNHLMSMDQWGGGGAGGGGANPGGGNPQARYANNTGGMRQPTHVMQTNLIPPQQQQQMMG
GLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQ
LALIMQKIKNNPTNESNQHILAILKQNPQIMAAIIKQRQQSQNNAAAGGGAPGPGGALQQ
QQAGNGPQNPQQQQQQQQQQQVMQQQQMQHMMNQQQGGGGPQQMNPNQQQQQQQVNLMQQ
QQQGGPGGPGSGLPTRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQ
YPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTV
PGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQ
PLQQQQMMQVAMPNANAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPT
PSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDV
GVGVGVGVGVGVNVNVGNVGVGNAGGALPDASDQLTKFVERL
NT seq 9849 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggat
atctcttactttctggaggagaacctgcccgatgagctggtgtcctcgaatagtggctgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaatcccacatccggcccaaatcccggtggcggacccaacaagccggcagcccaa
ggacccggctctggcacaggcggagtcggtgttggagtgaatgtgggtgtcggcggtgtt
gttggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggtggcgacgacggcagtggcaacggctcaggagcgggcaacagaatcagtcaaatg
caacaccagcaactgcagcacctactccagcagcagcagcagggccagaagggcgccatg
gtggtgcccggcatgcagcagctgggcagcaagtcgcccaacctgcagtcacccaaccag
ggcggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatgtca
atatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcgcag
ggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatggtt
aatcatcttaagcagcagcctggcggcggcggcggtgggatgatcaattccgtttcagta
cccggaggacctggagcaggagctggtggcgttggagctggcggcggaggagccgttgcc
gcaaaccaaggcatgcatatgcagaacggcccaatgatgggacgcatggtggggcaacag
catatgcttcgtggcccgcatctcatgggtgcctctggaggagctggtgggccaggaaac
gggcctggtggcggaggaccacgcatgcagaatccgaacatgcaaatgaatttccgtccg
tttgcagctcaactcaacagtctgccctacggagtgggtcagtatggtggcccaggcggt
ggtaacaatcctcagcaacagcagcagcaacagcagcaacaacttctcgcccagcagatg
gcccaaagaggtggcgtcgtaccgggcatgccgcagggtaatcggcccgttggcacagtg
gtgcccatgtccacactcggcggcgatggatcagggcccgcggggcagctggtaagcggg
aatcctcagcagcagcagatgctggcgcagcagcaaaccggagccatgggcccgcgtcct
ccgcaaccaaaccagctgctcggtcatcccggccagcagcagcagcagcaacagcagcct
ggcacctcgcagcagcagcaacagcagcagggagtcggaatcggaggagcaggcgttgtg
gccaatgcaggaaccgtggctggcgtgccggcagtggcaggcggcggagccggtggtgcc
gtacaatctagcggccctggtggcgccaatcgcgatgtgcccgacgaccgtaagcgacag
atccagcagcaactgatgctgctcctccatgcacacaaatgcaatcgcagggagaacctg
aatccgaacagggaagtgtgcaacgttaactactgcaaggcgatgaaatccgtgctggcc
cacatgggcacttgcaaacagagcaaggactgcaccatgcagcattgtgcctcttcgcgc
caaattctgttgcattataaaacgtgccagaacagtggctgcgtcatttgctatcccttc
cggcagaatcattcggtttttcaaaatgcgaatgtgccgccaggaggcggaccggcagga
attggaggtgcgccaccaggtggcggcggagcgggtggtggagcggctggagcaggcggt
aatcttcagcagcaacagcagcagcaacaacagcagcagcagaaccagcagcccaatctg
acgggtctggtagtggatggcaagcaaggacagcaggttgcaccgggaggtggccaaaat
actgccatagttcttccccagcaacagggagcgggcggtgcaccgggtgcgccgaaaacg
cctgcggatatggtgcaacaattgacccaacagcagcagcagcagcaacagcaggttcac
cagcaacaggttcagcaacaggaactccgtcgattcgatggcatgagccagcaagtcgta
gcaggtggtatgcaacagcagcagcagcagggtttgcctcctgtgattcgcattcaaggc
gctcagccggccgtcagggtactgggaccaggtggtcccggcggcccaagtggaccaaat
gttctgccgaacgatgttaacagcctgcatcaacaacagcaacaaatgctgcaacagcag
cagcaacagggccagaatcgacgacgcggtggcctggccaccatggtggagcaacaacag
cagcatcagcaacaacagcagcaacccaatcccgcccagctgggtggcaacattccagca
ccactctctgtcaacgtcggtggctttggcaataccaatttcggtggtgcagctgccggc
ggagccgtgggagccaacgataagcagcaactgaaggtggcccaagtgcatccgcagagc
catggcgtaggagcgggcggtgcatcagcgggcgccggggcgagtggtggtcaagtggca
gccggttccagtgtcctgatgccagccgataccacgggcagtggtaatgcgggcaatccc
aaccagaatgcaggcggtgtagctggaggtgccggcggtggcaatggcggaaacactgga
cctccgggcgacaacgagaaagactggcgggaatcggtgaccgccgatctgcgcaaccac
ctcgtccacaaactggtgcaggccatcttccccacctcggatcctacgaccatgcaggac
aaacggatgcataatctcgtttcatacgcggaaaaggtcgagaaggacatgtacgaaatg
gccaagtccagatcggagtactatcacctgctggccgagaagatctacaagattcaaaag
gagctggaggagaagcgactgaagcgtaaggagcagcatcagcagatgctgatgcagcaa
cagggcgttgcgaatccagtggctggaggagcggctggcggagcaggcagtgcagctggt
gtagcgggcggtgtagtcttgccccagcagcaacagcagcagcaacaacaacagcagcag
cagggtcagcagcctctgcagagctgtatccatccaagcatcagtccaatgggcggtgtg
atgccgccgcagcagctgcgtccacagggaccacctggaatactgggccaacagacggca
gcaggcctgggcgtcggcgtgggagtgaccaacaatatggttaccatgcgcagtcattcg
cccggtggcaacatgctcgccttgcagcaacaacagcgcatgcagttcccgcaacaacag
cagcaacaaccgccagggtctggagccggcaaaatgctggtcggtccaccaggacccagt
cccggtggcatggtggtcaatcccgcgctctcgccttaccagacgaccaatgtgctcacc
agtccggtgccaggacagcagcaacagcagcagttcattaatgcgaacggcggcactggc
gccaatcctcaactgagcgaaatcatgaagcagcgtcacattcaccagcagcagcagcaa
caacaacagcagcagcagcagggaatgttgttgccgcagtcgccatttagcaattcaaca
cctctacaacaacaacagcagcagcagcagcagcaacaacagcagcagcaggcgactagc
aacagttttagctcaccaatgcagcaacagcagcaaggtcagcaacagcaacaacagaag
cccggcagtgtgctgaataatatgccgcccacgcccacgagtctggaagccctgaatgcg
ggggccggagcgccgggaactggaggatccgcctccaatgtaacggtttcagctccgagc
ccatcgcctggcttcttgtccaacggcccgtcgattggcacgccctccaacaataataat
aatagtagtgctaacaacaacccgccctcggtgagcagtctaatgcaacagccgctgagc
aatcggccgggtacgcctccttacatacccgcttccccagtgccggcgacaagtgcctcc
ggattagcggcgagcagtacgcccgcatcagcagcagccacctgtgcgagtagtggcagt
ggcagcaatagcagcagcggagcaactgcagcgggtgcaagttccacgtcatcatcttcc
tcggcgggctcgggtacaccactcagctcggtatcgactcctacatcggccacgatggcc
accagcagcggtggtggtggtggtggtgggggcaatgcaggaggcggatcatccactacg
cccgctagcaatccactgctcctcatgtctggaggaacggcaggaggcggaacgggagca
acgaccaccacatcgacatcctcgagcagtcgcatgatgagcagctccagcagtctctcc
tcacagatggctgccctggaggctgcggcgcgagacaacgacgatgagacgccctcgcca
tccggcgagaatacgaacggcagtggtggcagtggaaatgccggcggtatggcctccaag
ggcaaactggactccattaagcaagatgatgatatcaagaaggagtttatggatgacagc
tgtggcggaaataacgatagctcgcagatggattgctcgacgggtggtggcaagggcaag
aatgtgaacaacgacggaacaagcatgatcaaaatggagatcaagacggaggatggactc
gatggcgaggtaaagatcaaaacggaggccatggatgtggacgaggctggaggatcgaca
gccggagagcatcatggcgaaggtggcggcggcagtggtgttggcggcggtaaggataac
ataaatggtgcgcacgatggcggagcgacaggcggtgctgtggacataaaacccaagacg
gagacgaaaccactcgtaccggagccactggcacccaatgcaggtgacaagaaaaagaag
tgccaattcaatcccgaggaactgcgcaccgctctcctgccaacgctagagaagctctac
aggcaggagcccgaatccgtgccctttcgctacccagttgatccccaggcgctgggcata
cctgattactttgaaatcgttaagaagcccatggacctgggcactatacgcaccaacatc
cagaatggaaagtacagtgatccctgggaatatgtggacgacgtttggctgatgttcgac
aatgcctggctgtataatcgcaaaacatcgcgggtctatcgctattgcacaaagctttcc
gaagtctttgaggcggagattgatcctgtgatgcaggcactgggatattgctgcggcagg
aagtacacattcaatccacaggtgctatgctgctacggcaagcagctctgcacgattccg
cgggatgccaagtactacagctaccagaacagtctaaaggaatacggtgtcgcctcaaat
agatacacctactgccaaaagtgctttaacgacatccagggcgatacggtcacactgggc
gacgatccactgcaatcgcaaacccaaatcaaaaaggatcagttcaaggagatgaagaac
gatcacctcgaactggagccgtttgtcaattgccaggagtgcggacgcaaacagcaccaa
atctgcgtactctggctggattctatctggcccggtggcttcgtgtgcgataactgcctg
aaaaagaagaactcaaagcggaaggagaacaagttcaatgcgaaacgcctgcccaccacc
aagctgggcgtgtacatagagacgcgggtgaataatttcctcaagaagaaggaggctggt
gccggcgaggtgcacattcgtgtggtcagctcatcggacaagtgtgtagaggtgaagccc
ggcatgcgtcgacgattcgtcgagcagggcgagatgatgaacgagttcccataccgagcc
aaagcgctctttgccttcgaggaggtggatggcatcgatgtgtgcttctttggcatgcac
gttcaggagtatggatccgagtgcccggcgccgaatacgcggcgtgtgtatattgcctat
ttggattccgttcatttcttccggccaagacagtaccgtacagcggtatatcacgaaatc
ctgctcggctatatggactacgtgaaacagctgggctacacaatggcccatatctgggcc
tgtccgccatccgagggcgatgactacatctttcactgccatcccacggaccagaagata
cccaagcccaagcgcctgcaggagtggtacaaaaagatgcttgacaagggaatgatcgag
cgcatcatacaggactacaaggatatcctgaagcaggcgatggaggacaaactgggctct
gccgcagagctgccctactttgagggcgacttctggcccaatgtgctggaggagagcatc
aaggaactggaccaggaggaggaagagaagcgcaaacaggccgaggccgcggaagcagca
gctgcggcaaatcttttctctatcgaggaaaatgaagtaagcggcgatggcaaaaagaag
ggccagaagaaggccaaaaagtcgaacaaatcgaaagcggcgcagcgtaagaacagcaaa
aagtccaacgaacatcagtcgggcaatgatctctccacaaagatatatgcgaccatggag
aagcacaaggaggtcttcttcgttatccgtctgcattcggcgcagtcggcagctagttta
gcgcccatccaggatcccgatccgctgctcacatgcgatctgatggatggacgcgatgcc
ttcctcacgctcgcccgcgacaagcactttgagttctcgtcgctgcggcgcgcacaattc
tccactctgtccatgttgtatgagctgcataaccagggtcaggacaagtttgtttacacc
tgcaaccactgcaagacggccgtggagacgcgctaccactgtactgtttgtgatgacttc
gatctgtgtatcgtgtgcaaggagaaggttggccatcagcacaagatggagaagctcggc
ttcgacatcgacgacggctctgcgctggcggatcacaagcaggctaatccacaggaggcc
cgcaagcaatccatccagcgttgcatccaatcgctggcgcacgcctgccagtgtcgcgat
gccaactgccgcctgccatcgtgccagaagatgaagctcgttgtccagcatacgaagaac
tgcaagcgcaagcccaacggaggatgccccatttgcaagcagcttatcgcactctgttgc
tatcacgcgaagaactgtgaggagcagaagtgccccgtgccgttctgtcccaacatcaag
cacaagctcaagcagcagcagtcacagcagaaattccagcagcagcagttgctgcgtcgc
cgtgtggcgctcatgtcgcgtacagcagctccagcggctctgcaaggcccagctgcagta
agcggtccgaccgtcgtctctggaggagtgcccgtggtgggcatgtccggtgtggcagtt
agccaacaggtgatccccggccaggcgggtatactgcctccaggggcgggtggcatgtcg
ccatctaccgtggcagttccatcgcctgtttcaggaggagcgggagccggtggaatgggt
ggaatgacatcaccacatccgcatcaaccaggtataggtatgaaacctggtggcggtcac
tcgccgtctccaaatgtcctacaagtggtgaagcaggtccaggaagaggcagctcgtcag
caggtatcgcatggcggtggcttcggcaagggcgtacccatggcgccgcccgtaatgaat
cgaccaatgggcggcgctgggcccaaccaaaatgttgttaatcaacttggtggcatgggc
gttggagttggaggtgtcggtggtgttggcgtcggaggcgttggtggagtgggtgttaat
caactgaattcgggtggtggcaatacacccggtgcacccatttccggtcccggaatgaat
gtcaatcatctaatgtccatggatcagtggggcggtggcggagccggcggcggaggtgcc
aatcccggcggtggcaatccacaagcccgctatgccaacaataccggcggcatgcgccaa
cccacccatgtgatgcaaacgaatctgataccgccgcagcaacagcaacagatgatgggc
ggactgggcggacccaaccaactgggaggtggccaaatgccagtcggcggacagcatgga
ggaatgggaatgggcatgggagcaccaccaatggccggaactgttggcggagtgcgtcca
tctcccggagcaggaggtggaggtggaagtgcgactgggggcggtctaaatacgcaacaa
ctcgccctgattatgcaaaagattaagaacaatcccaccaacgagagcaaccagcacatc
cttgccatactaaaacagaatccgcagatcatggcggcgatcatcaagcagcgccagcag
tcgcagaacaatgcggcagcgggcggaggagcacctggcccaggtggagccctacagcag
cagcaggccggtaacggaccgcaaaatcctcaacagcagcagcagcagcagcaacagcaa
caggtgatgcagcaacagcagatgcagcacatgatgaaccagcagcagggcggcggcggt
ccacagcagatgaatcccaaccagcagcagcaacagcagcaggttaatctcatgcagcag
cagcaacaaggtggacccggaggaccaggttctggacttcccacgcgcatgcccaatatg
cccaatgccttgggtatgctgcagagtcttccgcccaacatgtcgccaggcgtttctact
cagggaggaatggtgcccaaccaaaactggaacaagatgcgttacatgcaaatgagccag
tacccgccaccgtatccgcagcgccagcgtggcccgcacatgggcggagcgggacctggt
cccggccagcaacagttccccggtggcggaggtggagcgggcaactttaatgcgggtggt
gctggtggtgcaggcggcgttgtcggtgtgggcggagtgcccggaggtgccggcacggtg
cccggtggcgatcaatactcgatggcgaatgccgcggctgcctccaatatgctgcaacag
cagcagggccaggtgggcgtcggagtgggcgtgggcgtgaaaccaggacccggccaacag
caacagcagatgggcgttggcatgccgccgggtatgcagcagcaacagcagcaacagcaa
ccgctgcagcagcagcagatgatgcaggtagcaatgccaaatgcgaatgcccagaatccg
tcggcggtggttggcggacccaatgctcaggtgatgggtccgccgacgccgcactctctg
cagcagcagctgatgcaatcggcccgctcgtcgccgcctattcgctccccgcagccaacg
ccatcgccacgttcggctccatcgccacgtgctgctccatccgcctcgcctagggcacag
ccctcgccgcaccatgtgatgagcagtcactcgccagcgccgcagggaccaccgcatgac
ggcatgcacaatcatggcatgcatcatcagtcgccactgccaggagtgccgcaggatgtt
ggcgtcggagtcggtgtcggcgttggcgttggcgttaacgttaacgtcggcaacgtgggc
gtcggcaatgccggaggagccctgcccgacgcctccgaccagctgaccaagtttgtggag
cgactctag

  All links  
No link information was found.   
DBGET integrated database retrieval system