KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15319Help
Entry
Dmel_CG15319      CDS       T00030                                 

Gene name
nej
Definition
nejire (EC:2.3.1.48)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dme04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dme04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dme04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dme04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dme04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:8F7-8F9
AA seq 3282 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSNSGWSDQLTGGAGGGNGGGGASGV
TTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVVGVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPNQ
GGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGMV
NHLKQQPGGGGGGMINSVSVPGGPGAGAGGVGAGGGGAVAANQGMHMQNGPMMGRMVGQQ
HMLRGPHLMGASGGAGGPGNGPGGGGPRMQNPNMQMNFRPFAAQLNSLPYGVGQYGGPGG
GNNPQQQQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPAGQLVSG
NPQQQQMLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQQPGTSQQQQQQQGVGIGGAGVV
ANAGTVAGVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENL
NPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPF
RQNHSVFQNANVPPGGGPAGIGGAPPGGGGAGGGAAGAGGNLQQQQQQQQQQQQNQQPNL
TGLVVDGKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQQVH
QQQVQQQELRRFDGMSQQVVAGGMQQQQQQGLPPVIRIQGAQPAVRVLGPGGPGGPSGPN
VLPNDVNSLHQQQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQQQQPNPAQLGGNIPA
PLSVNVGGFGNTNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGASGGQVA
AGSSVLMPADTTGSGNAGNPNQNAGGVAGGAGGGNGGNTGPPGDNEKDWRESVTADLRNH
LVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQK
ELEEKRLKRKEQHQQMLMQQQGVANPVAGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQQ
QGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHS
PGGNMLALQQQQRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTTNVLT
SPVPGQQQQQQFINANGGTGANPQLSEIMKQRHIHQQQQQQQQQQQQGMLLPQSPFSNST
PLQQQQQQQQQQQQQQQATSNSFSSPMQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNA
GAGAPGTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNNSSANNNPPSVSSLMQQPLS
NRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSS
SAGSGTPLSSVSTPTSATMATSSGGGGGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGA
TTTTSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASK
GKLDSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEDGL
DGEVKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGATGGAVDIKPKT
ETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGI
PDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLS
EVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASN
RYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQ
ICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAG
AGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMH
VQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWA
CPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGS
AAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKK
GQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASL
APIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYT
CNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEA
RKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCC
YHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAV
SGPTVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGAGGMG
GMTSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMN
RPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSGGGNTPGAPISGPGMN
VNHLMSMDQWGGGGAGGGGANPGGGNPQARYANNTGGMRQPTHVMQTNLIPPQQQQQMMG
GLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQ
LALIMQKIKNNPTNESNQHILAILKQNPQIMAAIIKQRQQSQNNAAAGGGAPGPGGALQQ
QQAGNGPQNPQQQQQQQQQQQVMQQQQMQHMMNQQQGGGGPQQMNPNQQQQQQQVNLMQQ
QQQGGPGGPGSGLPTRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQ
YPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTV
PGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQ
PLQQQQMMQVAMPNANAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPT
PSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQGPPHDGMHNHGMHHQSPLPGVPQDV
GVGVGVGVGVGVNVNVGNVGVGNAGGALPDASDQLTKFVERL
NT seq 9849 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggat
atctcttactttctggaggagaacctgcccgatgagctggtgtcctcgaatagtggctgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaatcccacatccggcccaaatcccggtggcggacccaacaagccggcagcccaa
ggacccggctctggcacaggcggagtcggtgttggagtgaatgtgggtgtcggcggtgtt
gttggcgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccgga
acgggtggcgacgacggcagtggcaacggctcaggagcgggcaacagaatcagtcaaatg
caacaccagcaactgcagcacctactccagcagcagcagcagggccagaagggcgccatg
gtggtgcccggcatgcagcagctgggcagcaagtcgcccaacctgcagtcacccaaccag
ggcggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatgtca
atatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcgcag
ggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatggtt
aatcatcttaagcagcagcctggcggcggcggcggtgggatgatcaattccgtttcagta
cccggaggacctggagcaggagctggtggcgttggagctggcggcggaggagccgttgcc
gcaaaccaaggcatgcatatgcagaacggcccaatgatgggacgcatggtggggcaacag
catatgcttcgtggcccgcatctcatgggtgcctctggaggagctggtgggccaggaaac
gggcctggtggcggaggaccacgcatgcagaatccgaacatgcaaatgaatttccgtccg
tttgcagctcaactcaacagtctgccctacggagtgggtcagtatggtggcccaggcggt
ggtaacaatcctcagcaacagcagcagcaacagcagcaacaacttctcgcccagcagatg
gcccaaagaggtggcgtcgtaccgggcatgccgcagggtaatcggcccgttggcacagtg
gtgcccatgtccacactcggcggcgatggatcagggcccgcggggcagctggtaagcggg
aatcctcagcagcagcagatgctggcgcagcagcaaaccggagccatgggcccgcgtcct
ccgcaaccaaaccagctgctcggtcatcccggccagcagcagcagcagcaacagcagcct
ggcacctcgcagcagcagcaacagcagcagggagtcggaatcggaggagcaggcgttgtg
gccaatgcaggaaccgtggctggcgtgccggcagtggcaggcggcggagccggtggtgcc
gtacaatctagcggccctggtggcgccaatcgcgatgtgcccgacgaccgtaagcgacag
atccagcagcaactgatgctgctcctccatgcacacaaatgcaatcgcagggagaacctg
aatccgaacagggaagtgtgcaacgttaactactgcaaggcgatgaaatccgtgctggcc
cacatgggcacttgcaaacagagcaaggactgcaccatgcagcattgtgcctcttcgcgc
caaattctgttgcattataaaacgtgccagaacagtggctgcgtcatttgctatcccttc
cggcagaatcattcggtttttcaaaatgcgaatgtgccgccaggaggcggaccggcagga
attggaggtgcgccaccaggtggcggcggagcgggtggtggagcggctggagcaggcggt
aatcttcagcagcaacagcagcagcaacaacagcagcagcagaaccagcagcccaatctg
acgggtctggtagtggatggcaagcaaggacagcaggttgcaccgggaggtggccaaaat
actgccatagttcttccccagcaacagggagcgggcggtgcaccgggtgcgccgaaaacg
cctgcggatatggtgcaacaattgacccaacagcagcagcagcagcaacagcaggttcac
cagcaacaggttcagcaacaggaactccgtcgattcgatggcatgagccagcaagtcgta
gcaggtggtatgcaacagcagcagcagcagggtttgcctcctgtgattcgcattcaaggc
gctcagccggccgtcagggtactgggaccaggtggtcccggcggcccaagtggaccaaat
gttctgccgaacgatgttaacagcctgcatcaacaacagcaacaaatgctgcaacagcag
cagcaacagggccagaatcgacgacgcggtggcctggccaccatggtggagcaacaacag
cagcatcagcaacaacagcagcaacccaatcccgcccagctgggtggcaacattccagca
ccactctctgtcaacgtcggtggctttggcaataccaatttcggtggtgcagctgccggc
ggagccgtgggagccaacgataagcagcaactgaaggtggcccaagtgcatccgcagagc
catggcgtaggagcgggcggtgcatcagcgggcgccggggcgagtggtggtcaagtggca
gccggttccagtgtcctgatgccagccgataccacgggcagtggtaatgcgggcaatccc
aaccagaatgcaggcggtgtagctggaggtgccggcggtggcaatggcggaaacactgga
cctccgggcgacaacgagaaagactggcgggaatcggtgaccgccgatctgcgcaaccac
ctcgtccacaaactggtgcaggccatcttccccacctcggatcctacgaccatgcaggac
aaacggatgcataatctcgtttcatacgcggaaaaggtcgagaaggacatgtacgaaatg
gccaagtccagatcggagtactatcacctgctggccgagaagatctacaagattcaaaag
gagctggaggagaagcgactgaagcgtaaggagcagcatcagcagatgctgatgcagcaa
cagggcgttgcgaatccagtggctggaggagcggctggcggagcaggcagtgcagctggt
gtagcgggcggtgtagtcttgccccagcagcaacagcagcagcaacaacaacagcagcag
cagggtcagcagcctctgcagagctgtatccatccaagcatcagtccaatgggcggtgtg
atgccgccgcagcagctgcgtccacagggaccacctggaatactgggccaacagacggca
gcaggcctgggcgtcggcgtgggagtgaccaacaatatggttaccatgcgcagtcattcg
cccggtggcaacatgctcgccttgcagcaacaacagcgcatgcagttcccgcaacaacag
cagcaacaaccgccagggtctggagccggcaaaatgctggtcggtccaccaggacccagt
cccggtggcatggtggtcaatcccgcgctctcgccttaccagacgaccaatgtgctcacc
agtccggtgccaggacagcagcaacagcagcagttcattaatgcgaacggcggcactggc
gccaatcctcaactgagcgaaatcatgaagcagcgtcacattcaccagcagcagcagcaa
caacaacagcagcagcagcagggaatgttgttgccgcagtcgccatttagcaattcaaca
cctctacaacaacaacagcagcagcagcagcagcaacaacagcagcagcaggcgactagc
aacagttttagctcaccaatgcagcaacagcagcaaggtcagcaacagcaacaacagaag
cccggcagtgtgctgaataatatgccgcccacgcccacgagtctggaagccctgaatgcg
ggggccggagcgccgggaactggaggatccgcctccaatgtaacggtttcagctccgagc
ccatcgcctggcttcttgtccaacggcccgtcgattggcacgccctccaacaataataat
aatagtagtgctaacaacaacccgccctcggtgagcagtctaatgcaacagccgctgagc
aatcggccgggtacgcctccttacatacccgcttccccagtgccggcgacaagtgcctcc
ggattagcggcgagcagtacgcccgcatcagcagcagccacctgtgcgagtagtggcagt
ggcagcaatagcagcagcggagcaactgcagcgggtgcaagttccacgtcatcatcttcc
tcggcgggctcgggtacaccactcagctcggtatcgactcctacatcggccacgatggcc
accagcagcggtggtggtggtggtggtgggggcaatgcaggaggcggatcatccactacg
cccgctagcaatccactgctcctcatgtctggaggaacggcaggaggcggaacgggagca
acgaccaccacatcgacatcctcgagcagtcgcatgatgagcagctccagcagtctctcc
tcacagatggctgccctggaggctgcggcgcgagacaacgacgatgagacgccctcgcca
tccggcgagaatacgaacggcagtggtggcagtggaaatgccggcggtatggcctccaag
ggcaaactggactccattaagcaagatgatgatatcaagaaggagtttatggatgacagc
tgtggcggaaataacgatagctcgcagatggattgctcgacgggtggtggcaagggcaag
aatgtgaacaacgacggaacaagcatgatcaaaatggagatcaagacggaggatggactc
gatggcgaggtaaagatcaaaacggaggccatggatgtggacgaggctggaggatcgaca
gccggagagcatcatggcgaaggtggcggcggcagtggtgttggcggcggtaaggataac
ataaatggtgcgcacgatggcggagcgacaggcggtgctgtggacataaaacccaagacg
gagacgaaaccactcgtaccggagccactggcacccaatgcaggtgacaagaaaaagaag
tgccaattcaatcccgaggaactgcgcaccgctctcctgccaacgctagagaagctctac
aggcaggagcccgaatccgtgccctttcgctacccagttgatccccaggcgctgggcata
cctgattactttgaaatcgttaagaagcccatggacctgggcactatacgcaccaacatc
cagaatggaaagtacagtgatccctgggaatatgtggacgacgtttggctgatgttcgac
aatgcctggctgtataatcgcaaaacatcgcgggtctatcgctattgcacaaagctttcc
gaagtctttgaggcggagattgatcctgtgatgcaggcactgggatattgctgcggcagg
aagtacacattcaatccacaggtgctatgctgctacggcaagcagctctgcacgattccg
cgggatgccaagtactacagctaccagaacagtctaaaggaatacggtgtcgcctcaaat
agatacacctactgccaaaagtgctttaacgacatccagggcgatacggtcacactgggc
gacgatccactgcaatcgcaaacccaaatcaaaaaggatcagttcaaggagatgaagaac
gatcacctcgaactggagccgtttgtcaattgccaggagtgcggacgcaaacagcaccaa
atctgcgtactctggctggattctatctggcccggtggcttcgtgtgcgataactgcctg
aaaaagaagaactcaaagcggaaggagaacaagttcaatgcgaaacgcctgcccaccacc
aagctgggcgtgtacatagagacgcgggtgaataatttcctcaagaagaaggaggctggt
gccggcgaggtgcacattcgtgtggtcagctcatcggacaagtgtgtagaggtgaagccc
ggcatgcgtcgacgattcgtcgagcagggcgagatgatgaacgagttcccataccgagcc
aaagcgctctttgccttcgaggaggtggatggcatcgatgtgtgcttctttggcatgcac
gttcaggagtatggatccgagtgcccggcgccgaatacgcggcgtgtgtatattgcctat
ttggattccgttcatttcttccggccaagacagtaccgtacagcggtatatcacgaaatc
ctgctcggctatatggactacgtgaaacagctgggctacacaatggcccatatctgggcc
tgtccgccatccgagggcgatgactacatctttcactgccatcccacggaccagaagata
cccaagcccaagcgcctgcaggagtggtacaaaaagatgcttgacaagggaatgatcgag
cgcatcatacaggactacaaggatatcctgaagcaggcgatggaggacaaactgggctct
gccgcagagctgccctactttgagggcgacttctggcccaatgtgctggaggagagcatc
aaggaactggaccaggaggaggaagagaagcgcaaacaggccgaggccgcggaagcagca
gctgcggcaaatcttttctctatcgaggaaaatgaagtaagcggcgatggcaaaaagaag
ggccagaagaaggccaaaaagtcgaacaaatcgaaagcggcgcagcgtaagaacagcaaa
aagtccaacgaacatcagtcgggcaatgatctctccacaaagatatatgcgaccatggag
aagcacaaggaggtcttcttcgttatccgtctgcattcggcgcagtcggcagctagttta
gcgcccatccaggatcccgatccgctgctcacatgcgatctgatggatggacgcgatgcc
ttcctcacgctcgcccgcgacaagcactttgagttctcgtcgctgcggcgcgcacaattc
tccactctgtccatgttgtatgagctgcataaccagggtcaggacaagtttgtttacacc
tgcaaccactgcaagacggccgtggagacgcgctaccactgtactgtttgtgatgacttc
gatctgtgtatcgtgtgcaaggagaaggttggccatcagcacaagatggagaagctcggc
ttcgacatcgacgacggctctgcgctggcggatcacaagcaggctaatccacaggaggcc
cgcaagcaatccatccagcgttgcatccaatcgctggcgcacgcctgccagtgtcgcgat
gccaactgccgcctgccatcgtgccagaagatgaagctcgttgtccagcatacgaagaac
tgcaagcgcaagcccaacggaggatgccccatttgcaagcagcttatcgcactctgttgc
tatcacgcgaagaactgtgaggagcagaagtgccccgtgccgttctgtcccaacatcaag
cacaagctcaagcagcagcagtcacagcagaaattccagcagcagcagttgctgcgtcgc
cgtgtggcgctcatgtcgcgtacagcagctccagcggctctgcaaggcccagctgcagta
agcggtccgaccgtcgtctctggaggagtgcccgtggtgggcatgtccggtgtggcagtt
agccaacaggtgatccccggccaggcgggtatactgcctccaggggcgggtggcatgtcg
ccatctaccgtggcagttccatcgcctgtttcaggaggagcgggagccggtggaatgggt
ggaatgacatcaccacatccgcatcaaccaggtataggtatgaaacctggtggcggtcac
tcgccgtctccaaatgtcctacaagtggtgaagcaggtccaggaagaggcagctcgtcag
caggtatcgcatggcggtggcttcggcaagggcgtacccatggcgccgcccgtaatgaat
cgaccaatgggcggcgctgggcccaaccaaaatgttgttaatcaacttggtggcatgggc
gttggagttggaggtgtcggtggtgttggcgtcggaggcgttggtggagtgggtgttaat
caactgaattcgggtggtggcaatacacccggtgcacccatttccggtcccggaatgaat
gtcaatcatctaatgtccatggatcagtggggcggtggcggagccggcggcggaggtgcc
aatcccggcggtggcaatccacaagcccgctatgccaacaataccggcggcatgcgccaa
cccacccatgtgatgcaaacgaatctgataccgccgcagcaacagcaacagatgatgggc
ggactgggcggacccaaccaactgggaggtggccaaatgccagtcggcggacagcatgga
ggaatgggaatgggcatgggagcaccaccaatggccggaactgttggcggagtgcgtcca
tctcccggagcaggaggtggaggtggaagtgcgactgggggcggtctaaatacgcaacaa
ctcgccctgattatgcaaaagattaagaacaatcccaccaacgagagcaaccagcacatc
cttgccatactaaaacagaatccgcagatcatggcggcgatcatcaagcagcgccagcag
tcgcagaacaatgcggcagcgggcggaggagcacctggcccaggtggagccctacagcag
cagcaggccggtaacggaccgcaaaatcctcaacagcagcagcagcagcagcaacagcaa
caggtgatgcagcaacagcagatgcagcacatgatgaaccagcagcagggcggcggcggt
ccacagcagatgaatcccaaccagcagcagcaacagcagcaggttaatctcatgcagcag
cagcaacaaggtggacccggaggaccaggttctggacttcccacgcgcatgcccaatatg
cccaatgccttgggtatgctgcagagtcttccgcccaacatgtcgccaggcgtttctact
cagggaggaatggtgcccaaccaaaactggaacaagatgcgttacatgcaaatgagccag
tacccgccaccgtatccgcagcgccagcgtggcccgcacatgggcggagcgggacctggt
cccggccagcaacagttccccggtggcggaggtggagcgggcaactttaatgcgggtggt
gctggtggtgcaggcggcgttgtcggtgtgggcggagtgcccggaggtgccggcacggtg
cccggtggcgatcaatactcgatggcgaatgccgcggctgcctccaatatgctgcaacag
cagcagggccaggtgggcgtcggagtgggcgtgggcgtgaaaccaggacccggccaacag
caacagcagatgggcgttggcatgccgccgggtatgcagcagcaacagcagcaacagcaa
ccgctgcagcagcagcagatgatgcaggtagcaatgccaaatgcgaatgcccagaatccg
tcggcggtggttggcggacccaatgctcaggtgatgggtccgccgacgccgcactctctg
cagcagcagctgatgcaatcggcccgctcgtcgccgcctattcgctccccgcagccaacg
ccatcgccacgttcggctccatcgccacgtgctgctccatccgcctcgcctagggcacag
ccctcgccgcaccatgtgatgagcagtcactcgccagcgccgcagggaccaccgcatgac
ggcatgcacaatcatggcatgcatcatcagtcgccactgccaggagtgccgcaggatgtt
ggcgtcggagtcggtgtcggcgttggcgttggcgttaacgttaacgtcggcaacgtgggc
gtcggcaatgccggaggagccctgcccgacgcctccgaccagctgaccaagtttgtggag
cgactctag

DBGET integrated database retrieval system