KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15400Help
Entry
Dmel_CG15400      CDS       T00030                                 

Definition
CG15400 gene product from transcript CG15400-RB (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG15400
   00052 Galactose metabolism
    Dmel_CG15400
   00500 Starch and sucrose metabolism
    Dmel_CG15400
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG15400
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     Dmel_CG15400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:23B2-23B2
AA seq 350 aa AA seqDB search
MESIVHILSDAYHTTLTRELFINEWAQERLSFGRPLWHFLSVHLEPNKMFNIIIPLCGIF
SQEILVHLFTAFTLISTLNSFEKWIYPETRPLWFLREQFANNVVVKKPAVALESHQLSCE
MTGGLPCAHSMTFTVFVLILASFFFVHCWDRFAALRSSFCRCIMYLLIIGMVVCMWLSRL
YLATEFLHQCILGSYLGIRSLCTFEGNVKYLFSRPRRYAVSAVFFLGGLALSVYYVKLEL
NIDPHWSVREAFKWCPEPTYLRHEVGPIFALVRDLGNLMGLALASPLYKLEMKQSSFWRR
CRFLGVLEFVNYGLRFSTFKQSGRFVFLTYEFLRNVIHSLVLIKYVSKFY
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgatagtgcacattctttcggatgcgtaccatacaacgctcacgcgggagctt
ttcatcaacgaatgggctcaggaacgcttgagttttggaaggcccctttggcattttctc
agcgttcatttggagccaaacaaaatgttcaacatcattatccccctatgtggtatcttc
agtcaggaaatcctcgtgcatctcttcacggcatttaccctgattagcacactgaactcc
ttcgaaaaatggatatatccggagacgcgtcctttgtggtttctgcgagagcagtttgcc
aataatgtggttgtaaagaaaccggcggtggccttggaaagtcatcagctgagctgcgag
atgaccggtgggctgccctgcgcccactcaatgaccttcacggtgttcgtactcatcctg
gcctcgttcttcttcgttcactgctgggatcgctttgctgcgttgcgctcttccttctgc
cgctgcataatgtacctgctgatcattggaatggtggtctgtatgtggctgagtcgcctc
tacctggccaccgagtttctgcaccagtgcatactgggaagttacctgggaattaggtct
ctttgcacctttgagggaaatgtgaagtacttgttctcgcgaccacgtcgctatgcggtc
tcagctgttttcttcttgggaggattggcattgtcagtgtactatgtgaagctggaactg
aatatcgatccccattggtcggtgcgagaggcatttaaatggtgtccagaacccacatat
ttgcgtcatgaagttggtccaatctttgcacttgtcagagatctgggaaatctaatggga
ttggctttggcctcgccactatataagctggaaatgaaacaatcatcattttggcggcga
tgccgattccttggagttctggagtttgtcaactatggattgcgcttttccacgtttaag
cagtctggtcgcttcgttttcttgacctatgagttcttaagaaatgtcattcattcccta
gtactgattaagtacgtatcgaaattttactag

DBGET integrated database retrieval system