KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15433Help
Entry
Dmel_CG15433      CDS       T00030                                 

Gene name
Elp3
Definition
Elongator complex protein 3 (EC:2.3.1.- 2.7.1.- 2.7.11.19)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG15433 (Elp3)
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dmel_CG15433 (Elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:24F2-24F2
AA seq 552 aa AA seqDB search
MKAKKKLGVGLSRQERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLVASKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGECSIVRELHVY
GSVVPVNARDPTKFQHQGFGMLLMEEAERIAREEHGSTKLAVISGVGTRNYYRKMGYQLD
GPYMSKSIEENN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaaaaaagaagttgggcgtgggattgagccgccaggaacgacaggtgctcgtc
atcggggagatcattcaggagctgctgaaggcgcacgaagccaaaaaggatgtaaacctt
aatcggatgaaatcattggtggcctccaaatatggactggacagttcgccgcgcctggtc
gacataattgctgccgtgccgcaggacgccaaaaaaattctgcttccaaagctgagggca
aagcccattcgcacagcaagtggcatcgccgtggtcgccgtcatgtgcaagccgcatcgt
tgtccgcacatcaatatgaccggcaatatatgcgtctattgtcccggcggaccggacagc
gactttgagtactcgacacagtcgtacacaggctacgagccgacctcgatgcgagccatc
cggtcgcggtacgatccttttcttcagacccgacaccgcgttgaacagctgaagcagctg
ggacacagtgtggacaaggtggagttcatcgtaatgggcggtacgttcatgtgcctgccg
gaggagtaccgcgactactttatccgcaacctacacgacgccctctccggccacagcagc
gccaatgtggcggaagccgtacgctactcggagaagtcacgcacaaagtgcattggcatc
accatagaaacaaggccagattactgcctaaagcggcacatatcggatatgcttagctat
ggttgcacccggctggaaatcggtgtgcaatcggtttacgaagacgtggccagggatacg
aaccgcggacacacggtgcgagcggtgtgcgagagcttccagctgggcaaggatgctggc
tataagatcgtgacgcacatgatgcctgatcttcccaatgttgactttgaacgcgacatc
gagcagtttatcgagtactttgagaaccctgccttccgctctgacggcctaaagatctat
cccacgctcgtcattcgcggcactggtctctacgagttatggaaaaccgggcgatataag
tcatatccgccatccatgcttgtggacttagtggcgaagattttggcccttgtaccacca
tggacgcgagtgtaccgcgtacagcgcgacattcccatgccgcttgttagttccggcgtg
gaacacggaaatctccgtgaactggcgctggcccgcatgaaggatcttggaaccacttgc
cgcgatgttagaacccgcgaagttggcattcaggaaatccacaacaaggtgcgcccttac
gaaattgagctaattcgtcgggactatgtggccaatggcggctgggaaacgttcctctca
tacgaagatcctgaacaggacattctcgtaggccttcttaggctgcgaaagtgctcaccg
gataccttccgcccggaactgaagggcgaatgctccattgtgagggagctgcacgtatat
ggctcagtcgtgccggttaatgctagggatcccaccaagtttcagcaccagggcttcggt
atgttgctgatggaggaggcggagcgaattgctcgagaggagcacggcagcacaaaactg
gcggtcatatcgggagtgggcaccagaaactactatcgcaaaatgggataccaacttgac
ggaccctacatgtcaaagagcatagaagaaaataactag

DBGET integrated database retrieval system