KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15661Help
Entry
Dmel_CG15661      CDS       T00030                                 

Gene name
CG15661
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG15661 (CG15661)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG15661 (CG15661)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG15661 (CG15661)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG15661 (CG15661)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG15661 (CG15661)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG15661 (CG15661)
   00983 Drug metabolism - other enzymes
    Dmel_CG15661 (CG15661)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG15661 (CG15661)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG15661 (CG15661)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_trans_4_4 Glyco_transf_4 RSN1_TM
Motif
Other DBs
NCBI-GeneID: 37421
NCBI-ProteinID: NP_001036565
FlyBase: FBgn0034605
UniProt: Q9W2J3
Position
2R
AA seq 530 aa AA seqDB search
MQFPLLFGLLLTGTLYSQLELAEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVT
AFSLEKEQLGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTT
EHALRQPKVRSLIHAEQKEGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQ
MMGLITPWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPV
LTEVPKVKHMERQISVMLLNSHAPLTTARPTVDAMVPVGGMHIYPPKPLPADMQALLDGA
TEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESISQLPDNVMVRKWLP
QADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISLHFQ
SITEEILRHSLDQLIHNVTYKENVQRVSDIFRDRPLEPRKSAVYWIEYVIRHRGASHMRS
AGLDLNWFQFYLLDVIAFVAIIALAGVMALSLAIRLLMGSNKKHRKAKQN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccattattatttggcctccttctgactggaacattatattcccagttggaa
ttggccgaaggatcaaaaatcctggctgtgtatgcctttccgggaaaatcacattttatg
atgcacactgctttgataagggaacttgtcgaaagtggtcatcaggtgaccatggtaaca
gcttttagtctggagaaagagcaacttggcagcaactacacggagatcttgatagaaccg
gtctacgatttctggcacgatgttaagctgaactttggagcccaacacctattcgagctg
acccgcatgaccaactatgatttcctcaaaatgctggagattatcggcctcaagaccacc
gaacatgccctgcggcagcccaaggttcggtctctcattcatgccgagcaaaaggaagga
gtcttcgatcttctcctggccgagcagttctatcaggaggccttcttggcactggctcat
ctgtacaaaatacccgtggtgaccacgagcactttgggctatgagaatcacatgagtcag
atgatgggtctgattacaccttggtcctttgtaccacacggttttatgcccttcaccgat
cgcatgagtttcctggagagggtgaagaactcctatgcatccttctacgaagacatggac
aggctgctaaactattttccgaaaatggatgcggtggccagggagttctttggacccgta
ctgaccgaggtgcccaaggtcaagcacatggagcgtcaaatctcagtgatgctactaaac
agtcacgcaccgctgaccacggcacgtcccacagtggacgccatggtgccagtgggcggg
atgcacatctatccacccaaaccgctgccggctgacatgcaagccctcttggatggcgcc
accgagggggccatcttcttcagcctgggcagcaatgtccagagcaaggacatgcccgtg
gaaatgctgcgattgttcctgcaggtattcggttcgctcaagcagcgggtattgtggaaa
ttcgaggatgagagcattagccaattgccagataacgtgatggtcaggaagtggctgcca
caggccgacattctggcccatcgtcatgtgaaggtattcattacccacggtggcttattt
ggcacccaggagggagtgcattatgctgtgcccatgctgggtatacccttctactgtgat
cagcaccttaatatgaacaaagcggttttgggcggatatgccattagtctgcacttccaa
tcgattaccgaggaaatcctgcggcactccttggaccaacttatccataatgtgacctac
aaagagaacgttcagagggtatcggatattttccgcgatcgtccgctggagccgcgaaaa
agtgccgtctattggatcgaatatgtcatccggcatcgaggtgcttcacatatgagatcc
gcaggcctggatctcaactggttccaattctatttgctggatgtcatagcatttgtggct
atcattgctttagctggcgtcatggctctctcattggccattcgattactgatgggcagt
aataagaaacacaggaaagctaagcaaaattaa

DBGET integrated database retrieval system