KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15793Help
Entry
Dmel_CG15793      CDS       T00030                                 

Gene name
Dsor1
Definition
Downstream of raf1 (EC:2.7.11.- 2.7.11.13 2.7.11.24)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG15793 (Dsor1)
   04068 FoxO signaling pathway
    Dmel_CG15793 (Dsor1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG15793 (Dsor1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG15793 (Dsor1)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmel_CG15793 (Dsor1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:8D2-8D3; X:1-27.6 cM
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAELEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccattcaaaaccccctcgggcacagacacacacagt
ttgctggggaagcccaagacgagcatcgatgcgctgacagagacgctggagggtctggac
atgggcgacacggaacgcaagcggatcaagatgttcctcagccagaaggagaagatcggc
gagctgtccgacgaggatctggagaagctgggcgagctcggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcgatcaagaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttctacagcgacggcgagatcagtatc
tgcatggagtatatggacggtggatcacttgacctgatcctcaagcgggccggtcgaata
ccagagtccattctcggcaggatcacgctggcggtgctcaagggcttgagctatctgcgc
gacaatcacgccatcatccaccgtgacgtgaagccgagcaatatcctcgtcaatagcagc
ggcgagatcaagatctgtgatttcggcgtctccggtcaactgatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcacccactactcc
gtgcagtcggacatctggtcgttgggtctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
agcggccagccgacggacgagcccagggcaatggccatcttcgagctgctggattatatt
gtaaacgaaccgccgcccaagctagagcacaagatcttctccaccgagttcaaggacttc
gtggacatctgcctgaagaaacagcccgacgagcgggcagatctcaagaccctgctgagt
catccgtggatacgcaaggcggaattggaggaggtggatatatccggctgggtgtgcaag
acaatggacctgccgccatcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system