KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15817Help
Entry
Dmel_CG15817      CDS       T00030                                 

Definition
CG15817 gene product from transcript CG15817-RE (EC:3.1.2.15)
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dmel_CG15817
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dmel_CG15817
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG15817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:99A1-99A1
AA seq 1078 aa AA seqDB search
MHEYDVNERKEEPASLPPTQNETTEINSQLRQDQQNQEQENPLRQQDNSHPPQENPINQQ
EKDTLQVSVLYPLVVCAQLADSQLVLTADTPKLSPVKKRQRRVYVADTLRCYSLRSRQEP
ATKDPLEGGLKQPDVVPPPPPVQAPSPTPTESTEYTPPEQFKSEFWNRIEEAQEPKPVGK
KRRTPGGLKRTRGNKLLKELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSRKRTNTMS
LYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQEPQSHQYYGPNGGSNAAGAGAG
LNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHNLHHLIQDLNVVQQTIVRQ
QTARSASLGKNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSVT
EKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRET
NQSLIKAIGECPEVIANGYIANPDEVDTGEGQDRTDSTASQNLNAGNGSLATSQTTTTKT
SFFSRKSKRKDEVKPSKSTRVQSPLKENSPTAGGITGAGTAHATANSLFYLNTVDLSGAS
STSGSASTSASGVVSTSAALPTPPQATKYSSDDEMNSATVLKDKMRLEERIRELNLNFFS
SDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKEY
FRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFCA
TCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNSQ
TMASQAVPSNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMSK
NVKQVNGIISKNITNGIGKLSISTTCQGVNCCAMRLCCTQQTSSSNSTSCSDFSEESLQN
GSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCDDDKIKAMTQREFEELL
SPTRKITITPYLLFYARFDLQPQKATPPMPGSSTTPPPPSSAQSSWSNENVSSGSHKI
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggaaccagccagtcttccacccacacaa
aacgagaccactgaaatcaacagccagctacgacaggatcagcaaaatcaggaacaggag
aatcccctacggcagcaggataacagccacccgcctcaggaaaatccaattaatcagcag
gagaaggacacattgcaagtttccgttctttatcctctggtagtctgcgcgcagctggcg
gacagtcaactggttctgactgcggacacgccgaagctatctccagttaaaaagcgtcag
cggcgcgtttatgttgcggacaccttgcgctgctacagtctacgttcccggcaagagccc
gcgaccaaggacccactcgaaggtggcctaaagcagccggacgtcgttccaccacccccg
cctgtccaggcgccctctcccacgcccacagagtccacagaatacacacctccagaacaa
tttaaatcggagttttggaacagaattgaagaggctcaagagccaaagcctgttggaaag
aagcgacgaacccctggaggactcaaaagaacgcggggcaacaagcttctaaaagagctc
gagatccaatcgccggaaacggcggccgctattgcggcagcacaggcggaactcaacgcc
gcaggaaagtcgggagcagcaggagcacggtccagccgcaagaggaccaacacgatgtct
ctatacgatcggcgattccagacgaccaccgaggagcgccgcgtggctaacggatacggt
ggcaatgctgcgcgatcggtcactggctcctcgtcaaacgagatcgagtcccaggagccg
cagagtcatcagtattacggtcccaatggcggcagcaatgccgcgggagcaggcgcaggc
ttgaacggaagtgcggcggccctgaaccatgccccttccatgggcacactgtgcaacatt
ggcaacagttgctacttgaattctgtggtttacaccctgcgctttgccccgcactttttg
cacaacctacaccacctgatacaggacttgaatgttgtgcagcagacgatagttcgccaa
caaacggccaggtctgcgtccctcggcaaaaatgtgagtgccgctcagttggagcacgcc
cgcagctggagcagcaaggatctggccaccagtacggatcagtacagtggccagaatggc
ggagttaatagcggaaacggtggtagcggctcgagcaagtcgactcatcagtcggtaacc
gaaaaactccatgaactgtataacaacctgcacggcaacgagatggcagactccacggag
ccctaccacgcggacacgctgctgcacgccattcaggacgtaaacgccacctttgaaggt
aaccagcagcaggacgcacacgaattcctaatgtgcgtgcttaattgcatcagggaaacg
aatcagtctttgatcaaggccattggcgagtgtcctgaggtcatcgcaaatggatacata
gccaacccggatgaggtcgacaccggagagggacaggatcgcactgattcgactgcgtcg
cagaacctgaacgctggcaatggatcgctggcaactagtcaaacaaccacgaccaaaacg
tcgttcttctctcgcaaatcaaaaagaaaagacgaggtcaagccatccaagtcgacgcgc
gttcagtcgccactcaaggagaatagtcccacggcgggcgggataaccggtgcgggcaca
gcccatgccaccgccaacagcctgttctacctgaacacagttgatctcagcggcgccagc
agcaccagcggtagtgccagtacgagtgccagtggcgttgtttccacaagtgcagcgttg
cccacacccccgcaggctacaaaatactccagtgacgacgagatgaattccgccaccgtg
ctgaaggacaaaatgcgactggaggagcgaatacgggagctcaatctaaacttcttcagc
tcggacttcgaaggcattgtggtgctgaccaccaagtgcctcagttgcgagacgataacg
cggcaaaagcagggcatgcttgatatttctgtgccggtgccgatctcggggtacgacaat
gctgatctccaagacaaaccgagcacctacatacagaattcctgcattacgaaagagtat
ttccgcggggagaataagtatagttgcaaccagtgcaccggctacaccgaagccatccgc
tccatctcgtacgaggtgctgccgcggttactggtcattcagctgaatcgcttctctggc
ggcatggagaaagtgagtacgtacgtgccgaccaccttcactctgccctgtttctgcgcc
acctgctgtgagctgggcgagggcaacaagctgcacgtttacaagctgtacagcgtgatc
acgcatgtgggagccaccctgacggtgggccactacatcgcctatacgtgcttcttggat
ctcgccagtgactatgtcaactgccctaaggatcgcaggaatacgatgacgaactcgcaa
acgatggcttcgcaagcagtgccctccaatgagaatgctgcgccaaacaatggtagcagc
tccgtggccagcactccagttattgcagcagcttcggcattggcctcatcgggcaacatt
ttgatgaagaagatgaagttcggtcgcagcaaggcctccagcagtggtgatatgagcaag
aacgttaagcaggttaatgggataatcagcaagaacatcaccaatggaattggcaagctg
agcataagcaccacctgccaaggagtcaactgctgtgccatgaggctgtgttgcacccag
cagacgagcagcagcaactcgaccagttgcagtgatttcagcgaggagtccctgcaaaac
ggaagcaacagcaatctcagcttcggaggatcgggcagcacctatcccacgggctacgga
agcacgggtcgcggtggtgtcagagccaactacgcccacggaggtcctgatcccatttgg
tatatgtgcgacgacgacaagatcaaggcgatgacccaaagggagttcgaagagctgcta
tcgcccacacggaagatcacaataacgccgtatttgctcttttacgcgcgattcgatctg
cagccgcagaaggcgacgccgccgatgcctggatcatccacaacgcctccgccaccgtcg
tcggcacagagttcgtggtcgaatgaaaacgtgtccagcggctcgcacaaaatttga

DBGET integrated database retrieval system