KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15902Help
Entry
Dmel_CG15902      CDS       T00030                                 

Definition
(RefSeq) Ugt86Dj
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG15902
   00053 Ascorbate and aldarate metabolism
    Dmel_CG15902
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG15902
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG15902
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG15902
   00982 Drug metabolism - cytochrome P450
    Dmel_CG15902
   00983 Drug metabolism - other enzymes
    Dmel_CG15902
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG15902
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG15902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 53501
NCBI-ProteinID: NP_652619
FlyBase: FBgn0040250
UniProt: Q9VGS8
Position
3R
AA seq 529 aa AA seqDB search
MFPPGRWLLPMFWLISNSICWIRSSRILVIAPFESHSQCMLVTPYIQALKDRGHQLTVIH
AYKHCMHKIEDVTFIRIWYNNNVFLEFEESVGIASANNKWEEISSMSSLMANATLNVLNN
VEVRALMKSRITFDAVVLEAGYSDVLYGMAAHFSAQLIGICTCVADWNINNLVGFSTSTL
TEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKSFHEIRQ
DFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEAEHGVILFSLGL
EQDSKDLPRKTQEILVETFKSVPQRVIWKFDGESTMSLGTDIYHSKLLPQQAILAHPNVK
LFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEEGVALELNINSLTVKELKDAI
HSMINEPEYRESALAISQRFRDQPIHPLDAAIYWTEYIIRYKGADHMKISQSQLKLFDYY
SLDNFIMVGSRLSLVVALVFLVLSKSRRWLNHLSTSAKSFLPTKHLIRS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctccggggcgatggcttctcccgatgttctggctgatttcgaactcgatatgt
tggatacgtagttcccgcatcctcgtcatcgccccctttgaatcccactcgcaatgcatg
cttgtgacaccctatatccaggctctaaaagatcggggtcaccagctgacggtgatacat
gcatacaagcactgcatgcacaaaattgaggatgtcacctttatacgaatatggtataat
aataatgtttttttagagtttgaggaatccgttggaatcgcttcagcgaacaataagtgg
gaggaaattagttctatgtcgagtcttatggcaaatgctacgcttaatgtcctcaataat
gtggaagttcgagcattaatgaagtcaagaataacatttgacgcggtggtcctggaagct
ggatatagtgacgtgctctatggcatggcagcccatttcagcgcccaactgatcggaatt
tgcacctgcgtagcagattggaatataaataacctggtgggtttttcaacatccactttg
acagagcccataatgccatttcgtgcaaagtatgtgaaaaacgtttgggatcgcatctac
aattggttatacacaaccgaagagtggctgctgatcaacttggtatttttaccaaaacag
cgccttatccacgaccacttctttggccatctggagaagagcttccatgagatccggcaa
gactttgcattgatgctgctcaatcaacactttagcctgtttcgggccagacccaatgtg
ccgggaatggttgaagtagctggtctacacattcccaaagaggatccacagctgccgagc
gatctgcaagtgttcatcgatgaagcagaacatggagtgatcttgttttctctgggtctg
gaacaggacagtaaagatttgccaaggaaaacgcaggaaattctggtggagactttcaaa
tcggttccacagcgtgtgatttggaagttcgatggtgaatctacgatgagtctgggcact
gatatctaccactccaaacttttgccacagcaagcaattttggctcatccaaacgtaaag
ctctttataagccattgcggaatgatgagcgttatagaagctgcctactatgcgaagcca
gtattgggccttccatcgtttttcgatcaattcaggaatttggaaatcatgaaggaggag
ggagtagctctggagttgaacatcaatagcttgacagtaaaagagttgaaggatgctata
cacagcatgataaatgagccggaatatcgagagagtgccttggctatttcccaaagattt
agggatcagcccattcatcctttggatgcggccatttattggacggagtacataatacgc
tacaagggtgcagatcacatgaaaatatctcagtcccagttaaagttgttcgattactat
tccctggacaatttcataatggtcggatcgcggctatccttggtggtggctttagttttt
ctggtcctctcaaaaagcagaagatggctaaatcatttgtcaacatctgcaaagtcattt
ctacctacgaaacatctaattagaagttaa

DBGET integrated database retrieval system