KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15902Help
Entry
Dmel_CG15902      CDS       T00030                                 

Gene name
Ugt86Dj
Definition
CG15902 gene product from transcript CG15902-RA (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG15902 (Ugt86Dj)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG15902 (Ugt86Dj)
   00500 Starch and sucrose metabolism
    Dmel_CG15902 (Ugt86Dj)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG15902 (Ugt86Dj)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG15902 (Ugt86Dj)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG15902 (Ugt86Dj)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG15902 (Ugt86Dj)
   00983 Drug metabolism - other enzymes
    Dmel_CG15902 (Ugt86Dj)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG15902 (Ugt86Dj)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG15902 (Ugt86Dj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:86D5-86D6
AA seq 529 aa AA seqDB search
MFPPGRWLLPMFWLISNSICWIRSSRILVIAPFESHSQCMLVTPYIQALKDRGHQLTVIH
AYKHCMHKIEDVTFIRIWYNNNVFLEFEESVGIASANNKWEEISSMSSLMANATLNVLNN
VEVRALMKSRITFDAVVLEAGYSDVLYGMAAHFSAQLIGICTCVADWNINNLVGFSTSTL
TEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKSFHEIRQ
DFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEAEHGVILFSLGL
EQDSKDLPRKTQEILVETFKSVPQRVIWKFDGESTMSLGTDIYHSKLLPQQAILAHPNVK
LFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEEGVALELNINSLTVKELKDAI
HSMINEPEYRESALAISQRFRDQPIHPLDAAIYWTEYIIRYKGADHMKISQSQLKLFDYY
SLDNFIMVGSRLSLVVALVFLVLSKSRRWLNHLSTSAKSFLPTKHLIRS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctccggggcgatggcttctcccgatgttctggctgatttcgaactcgatatgt
tggatacgtagttcccgcatcctcgtcatcgccccctttgaatcccactcgcaatgcatg
cttgtgacaccctatatccaggctctaaaagatcggggtcaccagctgacggtgatacat
gcatacaagcactgcatgcacaaaattgaggatgtcacctttatacgaatatggtataat
aataatgtttttttagagtttgaggaatccgttggaatcgcttcagcgaacaataagtgg
gaggaaattagttctatgtcgagtcttatggcaaatgctacgcttaatgtcctcaataat
gtggaagttcgagcattaatgaagtcaagaataacatttgacgcggtggtcctggaagct
ggatatagtgacgtgctctatggcatggcagcccatttcagcgcccaactgatcggaatt
tgcacctgcgtagcagattggaatataaataacctggtgggtttttcaacatccactttg
acagagcccataatgccatttcgtgcaaagtatgtgaaaaacgtttgggatcgcatctac
aattggttatacacaaccgaagagtggctgctgatcaacttggtatttttaccaaaacag
cgccttatccacgaccacttctttggccatctggagaagagcttccatgagatccggcaa
gactttgcattgatgctgctcaatcaacactttagcctgtttcgggccagacccaatgtg
ccgggaatggttgaagtagctggtctacacattcccaaagaggatccacagctgccgagc
gatctgcaagtgttcatcgatgaagcagaacatggagtgatcttgttttctctgggtctg
gaacaggacagtaaagatttgccaaggaaaacgcaggaaattctggtggagactttcaaa
tcggttccacagcgtgtgatttggaagttcgatggtgaatctacgatgagtctgggcact
gatatctaccactccaaacttttgccacagcaagcaattttggctcatccaaacgtaaag
ctctttataagccattgcggaatgatgagcgttatagaagctgcctactatgcgaagcca
gtattgggccttccatcgtttttcgatcaattcaggaatttggaaatcatgaaggaggag
ggagtagctctggagttgaacatcaatagcttgacagtaaaagagttgaaggatgctata
cacagcatgataaatgagccggaatatcgagagagtgccttggctatttcccaaagattt
agggatcagcccattcatcctttggatgcggccatttattggacggagtacataatacgc
tacaagggtgcagatcacatgaaaatatctcagtcccagttaaagttgttcgattactat
tccctggacaatttcataatggtcggatcgcggctatccttggtggtggctttagttttt
ctggtcctctcaaaaagcagaagatggctaaatcatttgtcaacatctgcaaagtcattt
ctacctacgaaacatctaattagaagttaa

DBGET integrated database retrieval system