KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1633Help
Entry
Dmel_CG1633       CDS       T00030                                 

Gene name
Jafrac1
Definition
(RefSeq) thioredoxin peroxidase 1 (EC:1.11.1.- 1.11.1.7 1.11.1.9)
  KO
K13279  
peroxiredoxin 1 [EC:1.11.1.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dmel_CG1633 (Jafrac1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     Dmel_CG1633 (Jafrac1)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG1633 (Jafrac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11E11-11E11
AA seq 194 aa AA seqDB search
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAE
FRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGI
PFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMV
ADPTKSKEYFETTS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctacagaagcccgctcccgcattcgccggcaccgccgtcgtcaacggtgtt
ttcaaggacatcaagttgagcgactacaagggcaaatacctggtgcttttcttctacccg
ctggacttcaccttcgtgtgccccaccgagatcattgcgttctcggagagcgccgccgag
ttccgcaagatcaattgcgaggtgatcggttgctccacggacagccagttcacccacttg
gcctggatcaacacgccaaggaagcagggtggtctgggcagcatggacattccactgctg
gctgacaagtcgatgaaggtggcccgcgactatggagtgctcgatgaggagactggcatc
cccttccgcggcctgttcatcatcgatgacaagcagaacttgcgccagatcaccgtcaac
gatctgcccgtaggtcgcagtgtggaggagaccctgcgtctcgtccaggccttccagtac
accgacaagtacggcgaggtctgccccgccaactggaagcccggccagaagaccatggtg
gccgatcccaccaagtccaaggagtacttcgagaccacctcctaa

DBGET integrated database retrieval system