KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1633Help
Entry
Dmel_CG1633       CDS       T00030                                 

Gene name
Jafrac1
Definition
thioredoxin peroxidase 1 (EC:1.11.1.- 1.11.1.7 1.11.1.9)
Orthology
K03386  
peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11E11-11E11
AA seq 194 aa AA seqDB search
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAE
FRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGI
PFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMV
ADPTKSKEYFETTS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctacagaagcccgctcccgcattcgccggcaccgccgtcgtcaacggtgtt
ttcaaggacatcaagttgagcgactacaagggcaaatacctggtgcttttcttctacccg
ctggacttcaccttcgtgtgccccaccgagatcattgcgttctcggagagcgccgccgag
ttccgcaagatcaattgcgaggtgatcggttgctccacggacagccagttcacccacttg
gcctggatcaacacgccaaggaagcagggtggtctgggcagcatggacattccactgctg
gctgacaagtcgatgaaggtggcccgcgactatggagtgctcgatgaggagactggcatc
cccttccgcggcctgttcatcatcgatgacaagcagaacttgcgccagatcaccgtcaac
gatctgcccgtaggtcgcagtgtggaggagaccctgcgtctcgtccaggccttccagtac
accgacaagtacggcgaggtctgccccgccaactggaagcccggccagaagaccatggtg
gccgatcccaccaagtccaaggagtacttcgagaccacctcctaa

DBGET integrated database retrieval system