KEGG   Drosophila melanogaster (fruit fly): Dmel_CG16771Help
Entry
Dmel_CG16771      CDS       T00030                                 

Definition
CG16771 gene product from transcript CG16771-RE (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dme00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:37D7-37E1
AA seq 596 aa AA seqDB search
MEKRSGTPINSQKFRKLSDVDMTEVQLNNLDDSSAKETVEIGSFQGNDQSNPVQHTKWFR
SRLFLISVVFSALLITAMCIGFVVHYGMSGDVGDMETVSYWPVDLPKEQKEWYDQGIDEL
QKAVSRQFNRRRAKNVILFVGDGMGPNTVTAARILGVKEEGLLRWEQFPDMGLLKTYCAD
KQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHHVQTILKWAQVDGMRTG
FVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQLIEQPTGQSINVIMG
GGRQMLVSDVTGSAADPLDTWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRELWNLNG
QDVDYVLGIFANGHLMYDHERDRSDAGMPSLSNMTLKALEVLGNSDKGFLLVVEAGLIDQ
AHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPDRGSS
ILGLAGNSKTEGTPYTTLTYGTSYQGFQVDPQTQSRKDPTADDITAWEYTQQAAINTDEN
LHGGSDVTIHADGAMSYLFHGVHEQSYVAHAISYALRIGRFRDSSIAETLAELTPI
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcgaagtggaacgccgataaatagccaaaagtttcgaaaactcagcgatgtg
gacatgacggaagtgcagctgaacaatttggatgactccagtgccaaggagacggtggaa
ataggtagctttcagggcaatgaccagagcaatcccgtgcagcacacgaaatggttcaga
tccaggctcttcctcatatccgtggttttctcggccctcctgataaccgccatgtgcatt
ggcttcgttgtgcactacggcatgtccggcgatgtgggcgacatggagacggtgagctac
tggcccgtagatctgcccaaggagcaaaaggagtggtacgatcagggaatcgatgagctt
cagaaggccgtttccaggcagttcaatcgccggcgagccaagaacgtaatcctgttcgtg
ggcgatggaatgggtccgaacacggtgacggccgcacggatactcggagtcaaggaggag
ggactcctgcgttgggagcagtttccggacatgggactgctgaagacctactgtgccgac
aagcaagtaccggactcgttctccacggccacagctctctttggcggagtaaaggtaaac
tacgaaacgggaggagttgatgcaaatgtaccgctggggaactgcagcgcatccctgaag
gaggaccaccacgttcagacgatcctcaagtgggcccaggtggatggaatgcgaacgggt
ttcgtgaccaccacccgggtgacgcatgccactccggctgccctctacgcccacgtgccg
gatcgtcgatgggagtgtgagagcggaatgccagccgaggctcagggtcagggatgtatg
gacatagctcgccagctgatcgaacagccgacgggtcagagcataaacgtaatcatgggc
ggtggtcgtcagatgctggtctcagatgtaaccggttcagcagccgatcccctggacact
tgggccggccagtcgaaggatggacgagatctcatccgagattggaggctaaagaaagcg
gatgagggagtgtcacatgcggttgtgcaaaacaatcgtgagctgtggaatctcaatggt
caggatgttgactacgtacttggtattttcgccaatggacacctaatgtacgaccacgaa
cgagatcgcagtgacgccggcatgccctcgctgtccaatatgaccctcaaggcgctggag
gtcctgggaaacagtgataaggggtttctgctcgtggtggaagccggtctaatcgaccaa
gcccatcacaggggaaacgctcgaaaggcgctaagtgaggtgctcgaactgaacgcagcc
gttgagtctacactttccttcctcaagtcatcggatcgcctggacgaaaccttggtcatt
gtgaccgccgatcactcgcacagcctgaccatcaatgggcatcccgatcggggatccagt
atactcggcttggcgggaaactcgaagacagaagggacgccgtacaccacgttaacctat
ggcaccagctatcagggattccaggtggatccgcaaacgcagagccgcaaggatccaact
gctgacgatattaccgcctgggagtacacccagcaggcagcaatcaacacggacgagaat
ctgcacggtggctcggatgtaacgattcacgcggatggtgccatgtcctacttgttccac
ggcgtccacgagcagagctatgtggcgcacgccatatcgtacgccctgaggatcggaaga
ttccgggatagctccatcgcggaaactctggccgagctgacgcccatataa

DBGET integrated database retrieval system